StarFunc result for job id Q15319

User Input

>input (338 residues)
MMAMNSKQPFGMHPVLQEPKFSSLHSGSEAMRRVCLPAPQLQGNIFGSFDESLLARAEAL
AAVDIVSHGKNHPFKPDATYHTMSSVPCTSTSSTVPISHPAALTSHPHHAVHQGLEGDLL
EHISPTLSVSGLGAPEHSVMPAQIHPHHLGAMGHLHQAMGMSHPHTVAPHSAMPACLSDV
ESDPRELEAFAERFKQRRIKLGVTQADVGAALANLKIPGVGSLSQSTICRFESLTLSHNN
MIALKPVLQAWLEEAEAAYREKNSKPELFNGSERKRKRTSIAAPEKRSLEAYFAIQPRPS
SEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKYSAVH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15319	0.999	0.999	2.733E-42	338	1.000	1.000	Q15319.pdb.gz	PO4F3_HUMAN POU domain, class 4, transcription factor 3 OS=Homo sapiens OX=9606 GN=POU4F3 PE=1 SV=1
2	AFDB:G3V7L5	0.533	0.442	1.269E-28	412	0.740	0.607	G3V7L5.pdb.gz	PO4F2_RAT POU domain, class 4, transcription factor 2 OS=Rattus norvegicus OX=10116 GN=Pou4f2 PE=1 SV=1
3	AFDB:Q9UKI9	0.253	0.207	1.166E-13	436	0.334	0.259	Q9UKI9.pdb.gz	PO2F3_HUMAN POU domain, class 2, transcription factor 3 OS=Homo sapiens OX=9606 GN=POU2F3 PE=1 SV=3
4	AFDB:P79746	0.264	0.241	1.080E-12	378	0.337	0.302	P79746.pdb.gz	PO3F2_DANRE POU domain, class 3, transcription factor 2 OS=Danio rerio OX=7955 GN=pou3f2 PE=1 SV=1
5	AFDB:A0A2R8Y739	0.257	0.245	2.307E-12	361	0.305	0.285	A0A2R8Y739.pdb.gz	A0A2R8Y739_HUMAN POU domain protein OS=Homo sapiens OX=9606 GN=POU3F4 PE=1 SV=1
6	AFDB:B5ME60	0.287	0.183	1.701E-10	586	0.299	0.172	B5ME60.pdb.gz	B5ME60_HUMAN POU domain protein OS=Homo sapiens OX=9606 GN=POU2F2 PE=1 SV=4
7	AFDB:Q9VK71	0.249	0.113	8.585E-10	893	0.311	0.118	Q9VK71.pdb.gz	PDM2B_DROME POU domain protein 2, isoform B OS=Drosophila melanogaster OX=7227 GN=pdm2 PE=2 SV=2
8	AFDB:Q5MD19	0.214	0.166	9.968E-6	461	0.222	0.163	Q5MD19.pdb.gz
9	PDB:6t90K	0.203	0.894	3.480E-5	73	0.115	0.534	6t90K.pdb.gz	Mechanisms of OCT4-SOX2 motif readout on nucleosomes.
10	AFDB:Q9NJB5	0.185	0.078	4.005E-4	1081	0.210	0.066	Q9NJB5.pdb.gz	ONEC_DROME Homeobox protein onecut OS=Drosophila melanogaster OX=7227 GN=onecut PE=2 SV=2
11	AFDB:Q8C0C0	0.213	0.098	1.570E-3	836	0.163	0.066	Q8C0C0.pdb.gz	ZHX2_MOUSE Zinc fingers and homeoboxes protein 2 OS=Mus musculus OX=10090 GN=Zhx2 PE=1 SV=1
12	PDB:4egcA	0.150	0.100	1.231E-2	539	0.083	0.052	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
13	PDB:5iplF	0.097	0.114	3.471E-1	277	0.065	0.079	5iplF.pdb.gz	Structures of E. coli sigma S-transcription initiation complexes provide new insights into polymerase mechanism.
14	PDB:3dnvB	0.148	0.619	5.473E-1	71	0.038	0.183	3dnvB.pdb.gz	Molecular mechanisms of HipA-mediated multidrug tolerance and its neutralization by HipB.
15	PDB:3f51A	0.135	0.416	6.056E-1	94	0.047	0.170	3f51A.pdb.gz
16	PDB:3bviF	0.101	0.172	7.049E-1	173	0.068	0.133	3bviF.pdb.gz	Structural basis for the iron uptake mechanism of Helicobacter pylori ferritin
17	PDB:6dv9F	0.097	0.167	8.204E-1	174	0.065	0.126	6dv9F.pdb.gz	Structural basis of ECF-sigma-factor-dependent transcription initiation.
18	PDB:7f0rF	0.096	0.113	8.630E-1	278	0.065	0.079	7f0rF.pdb.gz	Pseudomonas aeruginosa SutA wedges RNAP lobe domain open to facilitate promoter DNA unwinding.
19	PDB:6jbqF	0.103	0.168	9.549E-1	186	0.077	0.140	6jbqF.pdb.gz	Structures and mechanism of transcription initiation by bacterial ECF factors.
20	PDB:6jcxF	0.098	0.152	1.111	186	0.101	0.183	6jcxF.pdb.gz	Structures and mechanism of transcription initiation by bacterial ECF factors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q15319	0.0	696	338	1.000	1.000	PO4F3_HUMAN POU domain, class 4, transcription factor 3 OS=Homo sapiens OX=9606 GN=POU4F3 PE=1 SV=1
2	Q63955	0.0	690	338	0.991	0.991	PO4F3_MOUSE POU domain, class 4, transcription factor 3 OS=Mus musculus OX=10090 GN=Pou4f3 PE=1 SV=2
3	Q90435	3.48e-180	503	331	0.822	0.840	PO4F3_DANRE POU domain, class 4, transcription factor 3 OS=Danio rerio OX=7955 GN=pou4f3 PE=2 SV=2
4	Q7SZN6	2.24e-151	431	366	0.746	0.689	Q7SZN6_DANRE POU domain protein OS=Danio rerio OX=7955 GN=brn3a PE=2 SV=1
5	Q6XZH1	4.01e-150	429	384	0.754	0.664	Q6XZH1_DANRE POU domain protein OS=Danio rerio OX=7955 GN=brn-3b PE=2 SV=1
6	Q12837	1.08e-147	424	409	0.731	0.604	PO4F2_HUMAN POU domain, class 4, transcription factor 2 OS=Homo sapiens OX=9606 GN=POU4F2 PE=1 SV=2
7	Q63934	1.28e-147	424	411	0.683	0.562	PO4F2_MOUSE POU domain, class 4, transcription factor 2 OS=Mus musculus OX=10090 GN=Pou4f2 PE=1 SV=1
8	G3V7L5	1.32e-147	424	412	0.683	0.561	PO4F2_RAT POU domain, class 4, transcription factor 2 OS=Rattus norvegicus OX=10116 GN=Pou4f2 PE=1 SV=1
9	Q01851	3.37e-101	306	419	0.429	0.346	PO4F1_HUMAN POU domain, class 4, transcription factor 1 OS=Homo sapiens OX=9606 GN=POU4F1 PE=1 SV=4
10	P20266	3.63e-101	306	420	0.429	0.345	PO4F1_RAT POU domain, class 4, transcription factor 1 OS=Rattus norvegicus OX=10116 GN=Pou4f1 PE=2 SV=3
11	P17208	3.74e-101	306	421	0.429	0.344	PO4F1_MOUSE POU domain, class 4, transcription factor 1 OS=Mus musculus OX=10090 GN=Pou4f1 PE=1 SV=3
12	P24350	2.05e-98	298	396	0.544	0.465	IPOU_DROME Inhibitory POU protein OS=Drosophila melanogaster OX=7227 GN=acj6 PE=1 SV=3
13	P13528	3.32e-81	253	357	0.444	0.420	UNC86_CAEEL Transcription factor unc-86 OS=Caenorhabditis elegans OX=6239 GN=unc-86 PE=1 SV=2
14	P16241	6.55e-46	163	427	0.234	0.185	CF1A_DROME POU domain protein CF1A OS=Drosophila melanogaster OX=7227 GN=vvl PE=2 SV=5
15	Q2VUE0	6.49e-44	153	260	0.228	0.296	Q2VUE0_COTJA POU domain protein OS=Coturnix japonica OX=93934 GN=Brn-1 PE=2 SV=1
16	P56222	2.26e-43	157	445	0.240	0.182	PO3F2_RAT POU domain, class 3, transcription factor 2 OS=Rattus norvegicus OX=10116 GN=Pou3f2 PE=1 SV=1
17	P62515	3.62e-43	154	361	0.225	0.211	PO3F4_MOUSE POU domain, class 3, transcription factor 4 OS=Mus musculus OX=10090 GN=Pou3f4 PE=2 SV=1
18	P62516	3.62e-43	154	361	0.225	0.211	PO3F4_RAT POU domain, class 3, transcription factor 4 OS=Rattus norvegicus OX=10116 GN=Pou3f4 PE=2 SV=1
19	A0A2R8Y739	3.86e-43	154	361	0.225	0.211	A0A2R8Y739_HUMAN POU domain protein OS=Homo sapiens OX=9606 GN=POU3F4 PE=1 SV=1
20	P20265	4.32e-43	156	443	0.240	0.183	PO3F2_HUMAN POU domain, class 3, transcription factor 2 OS=Homo sapiens OX=9606 GN=POU3F2 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15994 DUF4770	6.3e+02	12.0	Domain of unknown function (DUF4770)
2	PF05920 Homeobox_KN	5e+02	12.0	Homeobox KN domain
3	PF00046 Homeodomain	5.4e-14	63.1	Homeodomain
4	PF13560 HTH_31	3	19.6	Helix-turn-helix domain
5	PF00157 Pou	1.5e-28	109.8	Pou domain - N-terminal to homeobox domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000012131

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000021086	0.676	Growth factor independent 1 transcription repressor
2	9593.ENSGGOP00000009454	0.671	Estrogen receptor
3	9593.ENSGGOP00000001079	0.657	Atonal bHLH transcription factor 1
4	9593.ENSGGOP00000028215	0.653	Growth associated protein 43
5	9593.ENSGGOP00000026409	0.647	ISL LIM homeobox 1
6	9593.ENSGGOP00000023860	0.617	POU domain protein
7	9593.ENSGGOP00000017187	0.614	POU domain protein
8	9593.ENSGGOP00000002664	0.605	LIM homeobox 1
9	9593.ENSGGOP00000010318	0.585	LIM homeobox 5
10	9593.ENSGGOP00000007916	0.558	Belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Myosin family
11	9593.ENSGGOP00000006275	0.556	Brain-specific homeobox
12	9593.ENSGGOP00000027528	0.543	ISL LIM homeobox 2
13	9593.ENSGGOP00000016058	0.536	Atonal bHLH transcription factor 7
14	9593.ENSGGOP00000001822	0.534	Espin
15	9593.ENSGGOP00000009561	0.521	Cellular tumor antigen p53
16	9593.ENSGGOP00000019146	0.514	LIM homeobox 4
17	9593.ENSGGOP00000020724	0.512	LIM homeobox 3
18	9593.ENSGGOP00000024325	0.509	SRY-box 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000981	0.999	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000976	0.996	transcription cis-regulatory region binding
GO:0000977	0.990	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001228	0.980	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000978	0.966	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032501	0.996	multicellular organismal process
GO:0009889	0.978	regulation of biosynthetic process
GO:0019219	0.978	regulation of nucleobase-containing compound metabolic process
GO:0060255	0.966	regulation of macromolecule metabolic process
GO:0006355	0.958	regulation of DNA-templated transcription
GO:0048522	0.942	positive regulation of cellular process
GO:0009893	0.909	positive regulation of metabolic process
GO:0010604	0.873	positive regulation of macromolecule metabolic process
GO:0051173	0.865	positive regulation of nitrogen compound metabolic process
GO:0009891	0.857	positive regulation of biosynthetic process
GO:0007600	0.852	sensory perception
GO:0031325	0.824	positive regulation of cellular metabolic process
GO:0006357	0.821	regulation of transcription by RNA polymerase II
GO:0045935	0.807	positive regulation of nucleobase-containing compound metabolic process
GO:0032502	0.806	developmental process
GO:0045893	0.795	positive regulation of DNA-templated transcription
GO:0048856	0.759	anatomical structure development
GO:0007275	0.722	multicellular organism development
GO:0048731	0.714	system development
GO:0045944	0.609	positive regulation of transcription by RNA polymerase II
GO:0009987	0.602	cellular process
GO:0007605	0.564	sensory perception of sound
GO:0007399	0.537	nervous system development
GO:0048513	0.419	animal organ development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0032991	0.982	protein-containing complex
GO:0005737	0.925	cytoplasm
GO:0005667	0.514	transcription regulator complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]