StarFunc result for job id Q15326

User Input

>input (602 residues)
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAV
KDGLIVETLTVGCKGSKAGIEQEGYWLPGDEIDWETENHDWYCFECHLPGEVLICDLCFR
VYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKG
KDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADI
ARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQ
KEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREG
RFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEEPEPETEAVSS
SQEIPTMPQPIEKVSVSTQTKKLSASSPRMLHRSTQTTNDGVCQSMCHDKYTKIFNDFKD
RMKSDHKRETERVVREALEKLRSEMEEEKRQAVNKAVANMQGEMDRKCKQVKEKCKEEFV
EEIKKLATQHKQLISQTKKKQWCYNCEEEAMYHCCWNTSYCSIKCQQEHWHAEHKRTCRR
KR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E7EV75	0.615	0.600	3.834E-94	617	1.000	0.976	E7EV75.pdb.gz	E7EV75_HUMAN Zinc finger MYND-type containing 11 OS=Homo sapiens OX=9606 GN=ZMYND11 PE=1 SV=2
2	AFDB:J3QKD2	0.557	0.569	1.254E-87	585	0.940	0.968	J3QKD2.pdb.gz	J3QKD2_HUMAN Zinc finger MYND-type containing 11 OS=Homo sapiens OX=9606 GN=ZMYND11 PE=1 SV=2
3	AFDB:E7ENI9	0.558	0.587	5.810E-87	571	0.940	0.991	E7ENI9.pdb.gz	E7ENI9_HUMAN Zinc finger MYND-type containing 11 OS=Homo sapiens OX=9606 GN=ZMYND11 PE=1 SV=1
4	AFDB:B7Z2J6	0.370	0.406	4.536E-78	547	0.909	1.000	B7Z2J6.pdb.gz	B7Z2J6_HUMAN cDNA FLJ50504, highly similar to Mus musculus zinc finger, MYND domain containing 11 (Zmynd11), mRNA OS=Homo sapiens OX=9606 PE=1 SV=1
5	AFDB:A9UL18	0.741	0.701	5.328E-77	640	0.731	0.688	A9UL18.pdb.gz
6	AFDB:B0QZE2	0.249	0.279	1.405E-71	522	0.867	1.000	B0QZE2.pdb.gz	B0QZE2_HUMAN Zinc finger MYND-type containing 11 OS=Homo sapiens OX=9606 GN=ZMYND11 PE=1 SV=1
7	AFDB:A0A0G2K9F7	0.398	0.209	2.595E-23	1180	0.294	0.150	A0A0G2K9F7.pdb.gz	A0A0G2K9F7_RAT Zinc finger, MYND-type containing 8 OS=Rattus norvegicus OX=10116 GN=Zmynd8 PE=1 SV=2
8	AFDB:A0A087WVZ6	0.406	0.224	2.896E-23	1136	0.297	0.158	A0A087WVZ6.pdb.gz	A0A087WVZ6_HUMAN Zinc finger MYND-type containing 8 OS=Homo sapiens OX=9606 GN=ZMYND8 PE=1 SV=2
9	AFDB:D5LMF5	0.408	0.217	5.006E-23	1165	0.191	0.099	D5LMF5.pdb.gz	D5LMF5_XENLA Protein kinase C-binding protein 1 OS=Xenopus laevis OX=8355 GN=zmynd8.S PE=2 SV=1
10	AFDB:Q20741	0.226	0.644	4.264E-7	183	0.083	0.273	Q20741.pdb.gz	Q20741_CAEEL MYND-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=bra-1 PE=1 SV=1
11	PDB:6s01K	0.106	0.625	2.838E-3	86	0.033	0.233	6s01K.pdb.gz	Structure of H3K36-methylated nucleosome-PWWP complex reveals multivalent cross-gyre binding.
12	PDB:6dk4A	0.101	0.388	6.089E-2	135	0.028	0.126	6dk4A.pdb.gz	Crystal structure of Campylobacter jejuni peroxide regulator.
13	PDB:3j79V	0.074	0.249	8.456E-2	155	0.023	0.090	3j79V.pdb.gz	Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
14	PDB:1fp1D	0.092	0.152	9.435E-2	340	0.023	0.041	1fp1D.pdb.gz	Structures of two natural product methyltransferases reveal the basis for substrate specificity in plant O-methyltransferases.
15	PDB:7a6hP	0.112	0.371	1.112E-1	146	0.027	0.110	7a6hP.pdb.gz	Cryo-EM structures of human RNA polymerase III in its unbound and transcribing states.
16	PDB:6fail	0.093	0.183	1.544E-1	286	0.027	0.056	6fail.pdb.gz	Structure of a eukaryotic cytoplasmic pre-40S ribosomal subunit.
17	PDB:7vo0G	0.113	0.444	1.544E-1	131	0.023	0.107	7vo0G.pdb.gz	Structural basis of Streptomyces transcription activation by zinc uptake regulator.
18	PDB:7tjjI	0.113	0.173	1.631E-1	380	0.023	0.037	7tjjI.pdb.gz	A mechanism of origin licensing control through autoinhibition of S. cerevisiae ORC·DNA·Cdc6.
19	PDB:5svah	0.096	0.413	2.031E-1	118	0.027	0.136	5svah.pdb.gz	Structure of a Complete Mediator-RNA Polymerase II Pre-Initiation Complex.
20	PDB:1kywC	0.096	0.150	3.146E-1	361	0.020	0.033	1kywC.pdb.gz	Structural basis for the modulation of lignin monomer methylation by caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MRY2	0.0	956	482	0.799	0.998	A0A0A0MRY2_HUMAN Zinc finger MYND domain-containing protein 11 OS=Homo sapiens OX=9606 GN=ZMYND11 PE=1 SV=1
2	A0A2R8PVB4	0.0	926	629	0.741	0.709	A0A2R8PVB4_DANRE Zinc finger MYND domain-containing protein 11 isoform X1 OS=Danio rerio OX=7955 GN=BS69 PE=1 SV=1
3	B0QZE2	0.0	1037	522	0.865	0.998	B0QZE2_HUMAN Zinc finger MYND-type containing 11 OS=Homo sapiens OX=9606 GN=ZMYND11 PE=1 SV=1
4	B7Z2J6	0.0	1105	547	0.907	0.998	B7Z2J6_HUMAN cDNA FLJ50504, highly similar to Mus musculus zinc finger, MYND domain containing 11 (Zmynd11), mRNA OS=Homo sapiens OX=9606 PE=1 SV=1
5	E7ENI9	0.0	1127	571	0.949	1.000	E7ENI9_HUMAN Zinc finger MYND-type containing 11 OS=Homo sapiens OX=9606 GN=ZMYND11 PE=1 SV=1
6	E7EV75	0.0	1252	617	1.000	0.976	E7EV75_HUMAN Zinc finger MYND-type containing 11 OS=Homo sapiens OX=9606 GN=ZMYND11 PE=1 SV=2
7	Q08CT0	0.0	919	640	0.739	0.695	Q08CT0_DANRE Zinc finger MYND domain-containing protein 11 isoform 2 OS=Danio rerio OX=7955 GN=BS69 PE=1 SV=1
8	Q15326	0.0	1261	602	1.000	1.000	ZMY11_HUMAN Zinc finger MYND domain-containing protein 11 OS=Homo sapiens OX=9606 GN=ZMYND11 PE=1 SV=2
9	Q8R5C8	0.0	1237	602	0.977	0.977	ZMY11_MOUSE Zinc finger MYND domain-containing protein 11 OS=Mus musculus OX=10090 GN=Zmynd11 PE=1 SV=2
10	H7C4X9	9.88e-49	185	1095	0.169	0.093	H7C4X9_HUMAN Zinc finger MYND-type containing 8 (Fragment) OS=Homo sapiens OX=9606 GN=ZMYND8 PE=1 SV=2
11	A8C4G9	1.07e-48	185	1208	0.169	0.084	A8C4G9_RAT Spikar OS=Rattus norvegicus OX=10116 GN=Zmynd8 PE=1 SV=1
12	A0A8I5XZV4	1.09e-48	185	1256	0.171	0.082	A0A8I5XZV4_RAT Zinc finger, MYND-type containing 8 OS=Rattus norvegicus OX=10116 GN=Zmynd8 PE=1 SV=1
13	A0A8I5ZX36	1.09e-48	185	1212	0.171	0.085	A0A8I5ZX36_RAT Zinc finger, MYND-type containing 8 OS=Rattus norvegicus OX=10116 GN=Zmynd8 PE=1 SV=1
14	A0A0G2K9F7	1.13e-48	185	1176	0.164	0.084	A0A0G2K9F7_RAT Zinc finger, MYND-type containing 8 OS=Rattus norvegicus OX=10116 GN=Zmynd8 PE=1 SV=2
15	A0A8I5ZZH4	1.14e-48	185	1210	0.169	0.084	A0A8I5ZZH4_RAT Zinc finger, MYND-type containing 8 OS=Rattus norvegicus OX=10116 GN=Zmynd8 PE=1 SV=1
16	A0A087WV57	1.16e-48	183	767	0.164	0.129	A0A087WV57_HUMAN Zinc finger MYND-type containing 8 OS=Homo sapiens OX=9606 GN=ZMYND8 PE=1 SV=1
17	A0A8I6A294	1.18e-48	185	1232	0.171	0.084	A0A8I6A294_RAT Zinc finger, MYND-type containing 8 OS=Rattus norvegicus OX=10116 GN=Zmynd8 PE=1 SV=1
18	Q9ULU4	1.29e-48	185	1186	0.169	0.086	ZMYD8_HUMAN MYND-type zinc finger-containing chromatin reader ZMYND8 OS=Homo sapiens OX=9606 GN=ZMYND8 PE=1 SV=2
19	A0A087WVZ6	1.32e-48	184	1136	0.164	0.087	A0A087WVZ6_HUMAN Zinc finger MYND-type containing 8 OS=Homo sapiens OX=9606 GN=ZMYND8 PE=1 SV=2
20	A0A087WYS3	1.35e-48	184	1087	0.169	0.094	A0A087WYS3_HUMAN Zinc finger MYND-type containing 8 OS=Homo sapiens OX=9606 GN=ZMYND8 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11657 Activator-TraM	8.7e+02	11.1	Transcriptional activator TraM
2	PF00439 Bromodomain	4.6e-07	41.2	Bromodomain
3	PF06207 DUF1002	1.6e+02	13.2	Protein of unknown function (DUF1002)
4	PF00855 PWWP	2.4e-06	39.3	PWWP domain
5	PF01753 zf-MYND	40	15.7	MYND finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000016175

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000020450	0.725	EMSY, BRCA2 interacting transcriptional repressor
2	61853.ENSNLEP00000009373	0.694	Ras association (RalGDS/AF-6) domain family member 2
3	61853.ENSNLEP00000014952	0.691	Leucine zipper-EF-hand containing transmembrane protein 2
4	61853.ENSNLEP00000002997	0.639	Shadow of prion protein homolog (zebrafish)
5	61853.ENSNLEP00000014409	0.639	Sugar transporter SWEET
6	61853.ENSNLEP00000022449	0.639	Prion protein 2 (dublet)
7	61853.ENSNLEP00000010363	0.637	DEAF1 transcription factor
8	61853.ENSNLEP00000022184	0.637	Belongs to the histone H3 family.
9	61853.ENSNLEP00000007891	0.624	Zinc fingers and homeoboxes 3
10	61853.ENSNLEP00000006310	0.615	Elongation factor Tu GTP binding domain containing 2
11	61853.ENSNLEP00000005539	0.614	Zinc finger and BTB domain containing 38
12	61853.ENSNLEP00000000005	0.608	Prominin 2
13	61853.ENSNLEP00000002985	0.564	Chromobox homolog 1
14	61853.ENSNLEP00000001882	0.554	Male-specific lethal 1 homolog (Drosophila)
15	61853.ENSNLEP00000019338	0.510	Ras association (RalGDS/AF-6) domain family member 4
16	61853.ENSNLEP00000001867	0.504	Belongs to the histone H3 family.
17	61853.ENSNLEP00000016745	0.504	Histone H3
18	61853.ENSNLEP00000022272	0.504	Histone H3
19	61853.ENSNLEP00000023122	0.504	Belongs to the histone H3 family.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140030	0.996	modification-dependent protein binding
GO:0042393	0.996	histone binding
GO:0043167	0.994	ion binding
GO:0035064	0.993	methylated histone binding
GO:0043169	0.828	cation binding
GO:0046872	0.814	metal ion binding
GO:1901363	0.610	heterocyclic compound binding
GO:0097159	0.609	organic cyclic compound binding
GO:0046914	0.596	transition metal ion binding
GO:0003676	0.591	nucleic acid binding
GO:0140110	0.467	transcription regulator activity
GO:0003677	0.429	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0048519	0.985	negative regulation of biological process
GO:0019222	0.985	regulation of metabolic process
GO:0031323	0.981	regulation of cellular metabolic process
GO:0048523	0.973	negative regulation of cellular process
GO:0080090	0.966	regulation of primary metabolic process
GO:0060255	0.966	regulation of macromolecule metabolic process
GO:0051171	0.966	regulation of nitrogen compound metabolic process
GO:0048583	0.963	regulation of response to stimulus
GO:0050896	0.943	response to stimulus
GO:0019219	0.942	regulation of nucleobase-containing compound metabolic process
GO:0009987	0.922	cellular process
GO:0010556	0.882	regulation of macromolecule biosynthetic process
GO:0009966	0.855	regulation of signal transduction
GO:0010468	0.841	regulation of gene expression
GO:0051252	0.838	regulation of RNA metabolic process
GO:0031326	0.835	regulation of cellular biosynthetic process
GO:2001141	0.819	regulation of RNA biosynthetic process
GO:0008152	0.792	metabolic process
GO:0006355	0.770	regulation of DNA-templated transcription
GO:0043170	0.763	macromolecule metabolic process
GO:0044238	0.749	primary metabolic process
GO:0006807	0.736	nitrogen compound metabolic process
GO:1902531	0.711	regulation of intracellular signal transduction
GO:0032784	0.644	regulation of DNA-templated transcription elongation
GO:0048518	0.639	positive regulation of biological process
GO:0048585	0.617	negative regulation of response to stimulus
GO:0044237	0.613	cellular metabolic process
GO:0009968	0.608	negative regulation of signal transduction
GO:0019538	0.548	protein metabolic process
GO:0051716	0.539	cellular response to stimulus
GO:0048522	0.500	positive regulation of cellular process
GO:0009892	0.477	negative regulation of metabolic process
GO:0031324	0.364	negative regulation of cellular metabolic process
GO:1902532	0.358	negative regulation of intracellular signal transduction
GO:0009893	0.353	positive regulation of metabolic process
GO:0010605	0.344	negative regulation of macromolecule metabolic process
GO:0036211	0.330	protein modification process
GO:0051172	0.326	negative regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005737	0.345	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]