StarFunc result for job id Q15327

User Input

>input (319 residues)
MMVLKVEELVTGKKNGNGEAGEFLPEDFRDGEYEAAVTLEKQEDLKTLLAHPVTLGEQQW
KSEKQREAELKKKKLEQRSKLENLEDLEIIIQLKKRKKYRKTKVPVVKEPEPEIITEPVD
VPTFLKAALENKLPVVEKFLSDKNNPDVCDEYKRTALHRACLEGHLAIVEKLMEAGAQIE
FRDMLESTAIHWASRGGNLDVLKLLLNKGAKISARDKLLSTALHVAVRTGHYECAEHLIA
CEADLNAKDREGDTPLHDAVRLNRYKMIRLLIMYGADLNIKNCAGKTPMDLVLHWQNGTK
AIFDSLRENSYKTSRIATF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A384NYH5	0.677	0.677	3.017E-42	319	1.000	1.000	A0A384NYH5.pdb.gz	A0A384NYH5_HUMAN Ankyrin repeat domain 1 (Cardiac muscle) OS=Homo sapiens OX=9606 GN=ANKRD1 PE=2 SV=1
2	AFDB:F1NYV8	0.714	0.714	1.608E-33	319	0.712	0.712	F1NYV8.pdb.gz	F1NYV8_CHICK Ankyrin repeat domain 1 OS=Gallus gallus OX=9031 GN=ANKRD1 PE=4 SV=1
3	AFDB:Q812A3	0.601	0.626	4.371E-23	306	0.417	0.435	Q812A3.pdb.gz	ANR23_MOUSE Ankyrin repeat domain-containing protein 23 OS=Mus musculus OX=10090 GN=Ankrd23 PE=2 SV=1
4	AFDB:Q86SG2	0.588	0.615	7.765E-22	305	0.395	0.413	Q86SG2.pdb.gz	ANR23_HUMAN Ankyrin repeat domain-containing protein 23 OS=Homo sapiens OX=9606 GN=ANKRD23 PE=1 SV=1
5	AFDB:Q9WV06	0.621	0.606	1.035E-21	328	0.411	0.399	Q9WV06.pdb.gz	ANKR2_MOUSE Ankyrin repeat domain-containing protein 2 OS=Mus musculus OX=10090 GN=Ankrd2 PE=1 SV=3
6	AFDB:Q9GZV1	0.602	0.536	2.575E-21	360	0.433	0.383	Q9GZV1.pdb.gz	ANKR2_HUMAN Ankyrin repeat domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ANKRD2 PE=1 SV=3
7	AFDB:Q5T457	0.394	0.415	4.563E-16	300	0.351	0.373	Q5T457.pdb.gz	Q5T457_HUMAN Ankyrin repeat domain 2 OS=Homo sapiens OX=9606 GN=ANKRD2 PE=1 SV=1
8	AFDB:C9JIJ7	0.508	0.612	2.014E-12	263	0.191	0.232	C9JIJ7.pdb.gz	C9JIJ7_HUMAN Ankyrin repeat domain 7 OS=Homo sapiens OX=9606 GN=ANKRD7 PE=1 SV=2
9	AFDB:Q8NB46	0.513	0.154	2.955E-12	1076	0.188	0.056	Q8NB46.pdb.gz	ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens OX=9606 GN=ANKRD52 PE=1 SV=3
10	AFDB:Q923M0	0.299	0.185	4.134E-12	524	0.238	0.145	Q923M0.pdb.gz	PP16A_MOUSE Protein phosphatase 1 regulatory subunit 16A OS=Mus musculus OX=10090 GN=Ppp1r16a PE=1 SV=1
11	PDB:2dvwA	0.510	0.702	1.822E-11	229	0.182	0.253	2dvwA.pdb.gz
12	PDB:8cs9A	0.507	0.205	2.805E-11	796	0.160	0.064	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
13	PDB:6v9hC	0.424	0.493	3.235E-9	270	0.172	0.204	6v9hC.pdb.gz
14	PDB:1wg0A	0.488	0.632	8.855E-9	243	0.144	0.189	1wg0A.pdb.gz
15	PDB:6jd6B	0.455	0.739	1.023E-8	192	0.176	0.292	6jd6B.pdb.gz
16	PDB:5vkqA	0.393	0.099	1.239E-8	1499	0.154	0.033	5vkqA.pdb.gz
17	PDB:6pqpA	0.498	0.265	1.363E-8	615	0.150	0.078	6pqpA.pdb.gz	Structural Insights into Electrophile Irritant Sensing by the Human TRPA1 Channel.
18	PDB:6mwqA	0.461	0.303	1.733E-8	493	0.147	0.095	6mwqA.pdb.gz
19	PDB:4oauC	0.506	0.239	2.203E-8	692	0.154	0.071	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
20	PDB:1bd8A	0.431	0.838	8.849E-8	156	0.141	0.288	1bd8A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A384NYH5	0.0	653	319	1.000	1.000	A0A384NYH5_HUMAN Ankyrin repeat domain 1 (Cardiac muscle) OS=Homo sapiens OX=9606 GN=ANKRD1 PE=2 SV=1
2	Q15327	0.0	653	319	1.000	1.000	ANKR1_HUMAN Ankyrin repeat domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ANKRD1 PE=1 SV=2
3	Q865U8	0.0	600	319	0.953	0.953	ANKR1_PIG Ankyrin repeat domain-containing protein 1 OS=Sus scrofa OX=9823 GN=ANKRD1 PE=2 SV=1
4	Q8R560	0.0	578	319	0.912	0.912	ANKR1_RAT Ankyrin repeat domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Ankrd1 PE=1 SV=1
5	Q9CR42	0.0	569	319	0.903	0.903	ANKR1_MOUSE Ankyrin repeat domain-containing protein 1 OS=Mus musculus OX=10090 GN=Ankrd1 PE=1 SV=1
6	F1NYV8	1.30e-163	460	319	0.712	0.712	F1NYV8_CHICK Ankyrin repeat domain 1 OS=Gallus gallus OX=9031 GN=ANKRD1 PE=4 SV=1
7	Q7ZT11	5.22e-162	456	319	0.705	0.705	ANKR1_CHICK Ankyrin repeat domain-containing protein 1 OS=Gallus gallus OX=9031 GN=ANKRD1 PE=2 SV=1
8	Q9WV06	1.01e-79	247	328	0.354	0.345	ANKR2_MOUSE Ankyrin repeat domain-containing protein 2 OS=Mus musculus OX=10090 GN=Ankrd2 PE=1 SV=3
9	A0A0A0MRN9	1.39e-78	244	333	0.354	0.339	A0A0A0MRN9_HUMAN Ankyrin repeat domain 2 OS=Homo sapiens OX=9606 GN=ANKRD2 PE=1 SV=1
10	Q9GZV1	8.27e-78	243	360	0.354	0.314	ANKR2_HUMAN Ankyrin repeat domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ANKRD2 PE=1 SV=3
11	A0A8I6B0D0	1.75e-75	236	306	0.436	0.454	A0A8I6B0D0_RAT Ankyrin repeat domain 23 OS=Rattus norvegicus OX=10116 GN=Ankrd23 PE=4 SV=1
12	Q812A3	4.17e-75	234	306	0.426	0.444	ANR23_MOUSE Ankyrin repeat domain-containing protein 23 OS=Mus musculus OX=10090 GN=Ankrd23 PE=2 SV=1
13	D3ZVB9	5.45e-74	231	298	0.408	0.436	D3ZVB9_RAT Ankyrin repeat domain 23 OS=Rattus norvegicus OX=10116 GN=Ankrd23 PE=4 SV=3
14	Q86SG2	1.62e-71	225	305	0.354	0.370	ANR23_HUMAN Ankyrin repeat domain-containing protein 23 OS=Homo sapiens OX=9606 GN=ANKRD23 PE=1 SV=1
15	A0A8I6GH25	4.22e-51	172	273	0.373	0.436	A0A8I6GH25_RAT Ankyrin repeat domain 23 OS=Rattus norvegicus OX=10116 GN=Ankrd23 PE=4 SV=1
16	Q5T457	1.72e-50	171	300	0.276	0.293	Q5T457_HUMAN Ankyrin repeat domain 2 OS=Homo sapiens OX=9606 GN=ANKRD2 PE=1 SV=1
17	Q8NB46	2.76e-25	108	1076	0.204	0.060	ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens OX=9606 GN=ANKRD52 PE=1 SV=3
18	Q7KU95	1.27e-23	103	2404	0.191	0.025	Q7KU95_DROME Ankyrin 2, isoform M OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
19	X2JGD3	1.30e-23	103	2566	0.191	0.024	X2JGD3_DROME Ankyrin 2, isoform Y OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
20	M9MS19	1.32e-23	103	4230	0.191	0.014	M9MS19_DROME Ankyrin 2, isoform P OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	1.3e-22	90.4	Ankyrin repeat
2	PF12796 Ank_2	2.1e-34	129.3	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	9e-20	79.5	Ankyrin repeat
4	PF13637 Ank_4	6e-23	92.2	Ankyrin repeats (many copies)
5	PF13857 Ank_5	1.2e-22	91.0	Ankyrin repeats (many copies)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000360762

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000467141	0.991	Titin
2	9606.ENSP00000351790	0.984	Myopalladin
3	9606.ENSP00000217964	0.918	F-box-like/WD repeat-containing protein TBL1X
4	9606.ENSP00000417401	0.915	Helicase with zinc finger domain 2
5	9606.ENSP00000405574	0.913	F-box-like/WD repeat-containing protein TBL1XR1
6	9606.ENSP00000262188	0.912	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3
7	9606.ENSP00000385523	0.908	Peroxisome proliferator-activated receptor alpha
8	9606.ENSP00000419692	0.906	Retinoic acid receptor RXR-alpha
9	9606.ENSP00000262367	0.905	CREB-binding protein
10	9606.ENSP00000457466	0.905	Chromodomain-helicase-DNA-binding protein 9
11	9606.ENSP00000325690	0.901	Histone-arginine methyltransferase CARM1
12	9606.ENSP00000385216	0.901	Nuclear receptor coactivator 1
13	9606.ENSP00000399968	0.901	Nuclear receptor coactivator 2
14	9606.ENSP00000260129	0.900	Trimethylguanosine synthase
15	9606.ENSP00000300651	0.900	Mediator of RNA polymerase II transcription subunit 1
16	9606.ENSP00000363929	0.900	Nuclear receptor coactivator 6
17	9606.ENSP00000316029	0.849	Talin-1
18	9606.ENSP00000361626	0.822	Nuclease-sensitive element-binding protein 1
19	9606.ENSP00000261448	0.786	Calsequestrin-2
20	9606.ENSP00000398736	0.776	Protein CYR61

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008092	0.999	cytoskeletal protein binding
GO:0140110	0.394	transcription regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0050794	0.993	regulation of cellular process
GO:0050896	0.987	response to stimulus
GO:0048856	0.986	anatomical structure development
GO:0048518	0.978	positive regulation of biological process
GO:0019222	0.977	regulation of metabolic process
GO:0051716	0.975	cellular response to stimulus
GO:0060255	0.973	regulation of macromolecule metabolic process
GO:0048522	0.972	positive regulation of cellular process
GO:0060537	0.951	muscle tissue development
GO:0061061	0.945	muscle structure development
GO:0051171	0.943	regulation of nitrogen compound metabolic process
GO:0080090	0.942	regulation of primary metabolic process
GO:0031323	0.942	regulation of cellular metabolic process
GO:0048519	0.911	negative regulation of biological process
GO:0042221	0.898	response to chemical
GO:0048523	0.876	negative regulation of cellular process
GO:0032501	0.875	multicellular organismal process
GO:0010468	0.871	regulation of gene expression
GO:0007517	0.867	muscle organ development
GO:0070887	0.836	cellular response to chemical stimulus
GO:0009889	0.816	regulation of biosynthetic process
GO:0010033	0.815	response to organic substance
GO:0009892	0.785	negative regulation of metabolic process
GO:0019219	0.776	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.773	regulation of macromolecule biosynthetic process
GO:0009653	0.756	anatomical structure morphogenesis
GO:0010605	0.748	negative regulation of macromolecule metabolic process
GO:0009628	0.740	response to abiotic stimulus
GO:0031326	0.740	regulation of cellular biosynthetic process
GO:0006355	0.728	regulation of DNA-templated transcription
GO:0051172	0.715	negative regulation of nitrogen compound metabolic process
GO:0071310	0.707	cellular response to organic substance
GO:0010604	0.692	positive regulation of macromolecule metabolic process
GO:0031324	0.685	negative regulation of cellular metabolic process
GO:0030154	0.675	cell differentiation
GO:0006357	0.662	regulation of transcription by RNA polymerase II
GO:0009605	0.659	response to external stimulus
GO:0045934	0.654	negative regulation of nucleobase-containing compound metabolic process
GO:0010558	0.651	negative regulation of macromolecule biosynthetic process
GO:0031327	0.651	negative regulation of cellular biosynthetic process
GO:0031325	0.630	positive regulation of cellular metabolic process
GO:0051173	0.622	positive regulation of nitrogen compound metabolic process
GO:0006950	0.617	response to stress
GO:0070848	0.571	response to growth factor
GO:0032496	0.571	response to lipopolysaccharide
GO:0007519	0.562	skeletal muscle tissue development
GO:0042127	0.537	regulation of cell population proliferation
GO:0045935	0.505	positive regulation of nucleobase-containing compound metabolic process
GO:0071396	0.494	cellular response to lipid
GO:0014070	0.483	response to organic cyclic compound
GO:0060548	0.481	negative regulation of cell death
GO:0043069	0.461	negative regulation of programmed cell death
GO:0071495	0.452	cellular response to endogenous stimulus
GO:0007275	0.447	multicellular organism development
GO:0071216	0.402	cellular response to biotic stimulus
GO:0009891	0.391	positive regulation of biosynthetic process
GO:0010557	0.384	positive regulation of macromolecule biosynthetic process
GO:0042981	0.381	regulation of apoptotic process
GO:0071840	0.363	cellular component organization or biogenesis
GO:0007154	0.339	cell communication
GO:0051254	0.333	positive regulation of RNA metabolic process
GO:0023052	0.331	signaling
GO:0048731	0.327	system development
GO:0010646	0.322	regulation of cell communication
GO:0048583	0.319	regulation of response to stimulus
GO:0016043	0.318	cellular component organization
GO:0031328	0.316	positive regulation of cellular biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0070013	0.997	intracellular organelle lumen
GO:0005634	0.997	nucleus
GO:0043232	0.996	intracellular non-membrane-bounded organelle
GO:0031981	0.994	nuclear lumen
GO:0005654	0.984	nucleoplasm
GO:0005829	0.622	cytosol
GO:0099080	0.564	supramolecular complex
GO:0043292	0.448	contractile fiber
GO:0016020	0.320	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]