StarFunc result for job id Q15329

User Input

>input (346 residues)
MAAAEPASSGQQAPAGQGQGQRPPPQPPQAQAPQPPPPPQLGGAGGGSSRHEKSLGLLTT
KFVSLLQEAKDGVLDLKAAADTLAVRQKRRIYDITNVLEGIDLIEKKSKNSIQWKGVGAG
CNTKEVIDRLRYLKAEIEDLELKERELDQQKLWLQQSIKNVMDDSINNRFSYVTHEDICN
CFNGDTLLAIQAPSGTQLEVPIPEMGQNGQKKYQINLKSHSGPIHVLLINKESSSSKPVV
FPVPPPDDLTQPSSQSLTPVTPQKSSMATQNLPEQHVSERSQALQQTSATDISSAGSISG
DIIDELMSSDVFPLLRLSPTPADDYNFNLDDNEGVCDLFDVQILNY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15329	1.000	1.000	1.312E-59	346	1.000	1.000	Q15329.pdb.gz	E2F5_HUMAN Transcription factor E2F5 OS=Homo sapiens OX=9606 GN=E2F5 PE=1 SV=1
2	AFDB:Q16254	0.554	0.468	1.761E-33	413	0.613	0.513	Q16254.pdb.gz	E2F4_HUMAN Transcription factor E2F4 OS=Homo sapiens OX=9606 GN=E2F4 PE=1 SV=2
3	AFDB:Q6DE14	0.560	0.519	4.055E-33	375	0.581	0.536	Q6DE14.pdb.gz	E2F4_XENLA Transcription factor E2F4 OS=Xenopus laevis OX=8355 GN=e2f4 PE=1 SV=1
4	AFDB:P56931	0.335	0.267	1.222E-20	443	0.364	0.284	P56931.pdb.gz	E2F2_MOUSE Transcription factor E2F2 OS=Mus musculus OX=10090 GN=E2f2 PE=1 SV=2
5	AFDB:Q14209	0.329	0.265	2.176E-20	437	0.355	0.281	Q14209.pdb.gz	E2F2_HUMAN Transcription factor E2F2 OS=Homo sapiens OX=9606 GN=E2F2 PE=1 SV=1
6	AFDB:Q9FV71	0.342	0.260	5.342E-20	469	0.329	0.243	Q9FV71.pdb.gz	E2FB_ARATH Transcription factor E2FB OS=Arabidopsis thaliana OX=3702 GN=E2FB PE=1 SV=1
7	AFDB:O00716	0.373	0.292	1.398E-19	465	0.318	0.237	O00716.pdb.gz	E2F3_HUMAN Transcription factor E2F3 OS=Homo sapiens OX=9606 GN=E2F3 PE=1 SV=1
8	AFDB:Q9FNY0	0.348	0.255	1.491E-19	485	0.327	0.233	Q9FNY0.pdb.gz	E2FA_ARATH Transcription factor E2FA OS=Arabidopsis thaliana OX=3702 GN=E2FA PE=1 SV=1
9	AFDB:Q01094	0.326	0.265	3.659E-19	437	0.350	0.277	Q01094.pdb.gz	E2F1_HUMAN Transcription factor E2F1 OS=Homo sapiens OX=9606 GN=E2F1 PE=1 SV=1
10	AFDB:O09139	0.348	0.290	1.500E-18	432	0.324	0.259	O09139.pdb.gz	E2F1_RAT Transcription factor E2F1 OS=Rattus norvegicus OX=10116 GN=E2f1 PE=1 SV=2
11	PDB:6r7fC	0.146	0.128	6.697E-2	403	0.029	0.025	6r7fC.pdb.gz
12	PDB:5hs7A	0.157	0.465	8.656E-2	102	0.032	0.108	5hs7A.pdb.gz
13	PDB:3jckF	0.185	0.168	1.049E-1	388	0.032	0.028	3jckF.pdb.gz	Atomic structure of the 26S proteasome lid reveals the mechanism of deubiquitinase inhibition.
14	PDB:4a6dA	0.148	0.149	1.193E-1	345	0.035	0.035	4a6dA.pdb.gz	Crystal Structure and Functional Mapping of Human Asmt, the Last Enzyme of the Melatonin Synthesis Pathway.
15	PDB:5znxA	0.160	0.484	1.356E-1	95	0.035	0.126	5znxA.pdb.gz
16	PDB:6hixBN	0.155	0.235	1.356E-1	214	0.052	0.084	6hixBN.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
17	PDB:1tw2B	0.150	0.148	1.446E-1	350	0.038	0.037	1tw2B.pdb.gz	Crystal structure of a ternary complex of DnrK, a methyltransferase in daunorubicin biosynthesis, with bound products
18	PDB:5l4kO	0.176	0.165	1.644E-1	376	0.040	0.037	5l4kO.pdb.gz
19	PDB:2ip2A	0.144	0.151	1.753E-1	330	0.020	0.021	2ip2A.pdb.gz
20	PDB:6hivBN	0.155	0.235	1.753E-1	214	0.052	0.084	6hivBN.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q15329	0.0	706	346	1.000	1.000	E2F5_HUMAN Transcription factor E2F5 OS=Homo sapiens OX=9606 GN=E2F5 PE=1 SV=1
2	Q61502	0.0	554	335	0.882	0.910	E2F5_MOUSE Transcription factor E2F5 OS=Mus musculus OX=10090 GN=E2f5 PE=1 SV=2
3	Q62814	0.0	534	300	0.827	0.953	E2F5_RAT Transcription factor E2F5 (Fragment) OS=Rattus norvegicus OX=10116 GN=E2f5 PE=2 SV=1
4	H0YBK0	1.40e-127	364	182	0.514	0.978	H0YBK0_HUMAN E2F transcription factor 5 (Fragment) OS=Homo sapiens OX=9606 GN=E2F5 PE=1 SV=1
5	E5RHD4	3.46e-113	328	173	0.468	0.936	E5RHD4_HUMAN E2F transcription factor 5 OS=Homo sapiens OX=9606 GN=E2F5 PE=1 SV=1
6	Q6DE14	3.40e-110	328	375	0.572	0.528	E2F4_XENLA Transcription factor E2F4 OS=Xenopus laevis OX=8355 GN=e2f4 PE=1 SV=1
7	Q8R0K9	1.93e-101	306	410	0.465	0.393	E2F4_MOUSE Transcription factor E2F4 OS=Mus musculus OX=10090 GN=E2f4 PE=1 SV=1
8	Q16254	1.16e-100	305	413	0.471	0.395	E2F4_HUMAN Transcription factor E2F4 OS=Homo sapiens OX=9606 GN=E2F4 PE=1 SV=2
9	Q9FV71	6.09e-50	175	469	0.324	0.239	E2FB_ARATH Transcription factor E2FB OS=Arabidopsis thaliana OX=3702 GN=E2FB PE=1 SV=1
10	Q9FNY0	2.04e-48	171	485	0.292	0.208	E2FA_ARATH Transcription factor E2FA OS=Arabidopsis thaliana OX=3702 GN=E2FA PE=1 SV=1
11	Q14209	2.31e-43	157	437	0.347	0.275	E2F2_HUMAN Transcription factor E2F2 OS=Homo sapiens OX=9606 GN=E2F2 PE=1 SV=1
12	Q9FV70	3.51e-42	153	396	0.257	0.225	E2FC_ARATH Transcription factor E2FC OS=Arabidopsis thaliana OX=3702 GN=E2FC PE=1 SV=1
13	O35261	1.74e-41	152	457	0.344	0.260	E2F3_MOUSE Transcription factor E2F3 OS=Mus musculus OX=10090 GN=E2f3 PE=1 SV=2
14	P56931	3.58e-41	151	443	0.341	0.266	E2F2_MOUSE Transcription factor E2F2 OS=Mus musculus OX=10090 GN=E2f2 PE=1 SV=2
15	O00716	1.92e-40	149	465	0.341	0.254	E2F3_HUMAN Transcription factor E2F3 OS=Homo sapiens OX=9606 GN=E2F3 PE=1 SV=1
16	F4ILT1	5.92e-40	149	514	0.257	0.173	F4ILT1_ARATH E2F transcription factor 3 OS=Arabidopsis thaliana OX=3702 GN=E2F3 PE=1 SV=1
17	G5EF11	1.14e-39	145	342	0.246	0.249	G5EF11_CAEEL E2F/DP family winged-helix DNA-binding domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=efl-1 PE=1 SV=1
18	O54917	1.77e-32	124	272	0.217	0.276	E2F6_MOUSE Transcription factor E2F6 OS=Mus musculus OX=10090 GN=E2f6 PE=2 SV=2
19	Q01094	8.99e-32	125	437	0.309	0.245	E2F1_HUMAN Transcription factor E2F1 OS=Homo sapiens OX=9606 GN=E2F1 PE=1 SV=1
20	A0A0S2Z3K8	1.04e-31	122	281	0.211	0.260	A0A0S2Z3K8_HUMAN E2F transcription factor 6 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=E2F6 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16421 E2F_CC-MB	7.6e-27	104.8	E2F transcription factor CC-MB domain
2	PF02319 E2F_TDP	1.2e-22	90.8	E2F/DP family winged-helix DNA-binding domain
3	PF00941 FAD_binding_5	1.3e+02	13.8	FAD binding domain in molybdopterin dehydrogenase
4	PF15471 TMEM171	5.6e+02	10.9	Transmembrane protein family 171

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000398124

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000362768	0.999	Retinoblastoma-like protein 1
2	9606.ENSP00000364519	0.999	Transcription factor Dp-1
3	9606.ENSP00000262133	0.996	Retinoblastoma-like protein 2
4	9606.ENSP00000257904	0.980	Cyclin-dependent kinase 4
5	9606.ENSP00000420616	0.978	Transcription factor Dp-2
6	9606.ENSP00000265734	0.977	Cyclin-dependent kinase 6
7	9606.ENSP00000266970	0.977	Cyclin-dependent kinase 2
8	9606.ENSP00000267163	0.975	Retinoblastoma-associated protein
9	9606.ENSP00000262643	0.971	G1/S-specific cyclin-E1
10	9606.ENSP00000378699	0.971	Cyclin-dependent kinase 1
11	9606.ENSP00000227507	0.968	G1/S-specific cyclin-D1
12	9606.ENSP00000209728	0.964	Cell division control protein 6 homolog
13	9606.ENSP00000261254	0.964	G1/S-specific cyclin-D2
14	9606.ENSP00000362082	0.964	G1/S-specific cyclin-D3
15	9606.ENSP00000217026	0.962	Myb-related protein B
16	9606.ENSP00000332973	0.961	Mothers against decapentaplegic homolog 3
17	9606.ENSP00000341551	0.957	Mothers against decapentaplegic homolog 4
18	9606.ENSP00000263253	0.956	Histone acetyltransferase p300
19	9606.ENSP00000384849	0.956	Cyclin-dependent kinase inhibitor 1
20	9606.ENSP00000479618	0.956	Myc proto-oncogene protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003700	1.000	DNA-binding transcription factor activity
GO:0003677	0.985	DNA binding
GO:0001216	0.981	DNA-binding transcription activator activity
GO:0043565	0.927	sequence-specific DNA binding
GO:1990837	0.619	sequence-specific double-stranded DNA binding
GO:0001067	0.586	transcription regulatory region nucleic acid binding
GO:0000976	0.584	transcription cis-regulatory region binding
GO:0000981	0.324	DNA-binding transcription factor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0010468	0.996	regulation of gene expression
GO:1903506	0.995	regulation of nucleic acid-templated transcription
GO:0006355	0.993	regulation of DNA-templated transcription
GO:0009987	0.991	cellular process
GO:0051726	0.984	regulation of cell cycle
GO:0044770	0.935	cell cycle phase transition
GO:0044772	0.911	mitotic cell cycle phase transition
GO:0044843	0.909	cell cycle G1/S phase transition
GO:0000082	0.871	G1/S transition of mitotic cell cycle
GO:0048518	0.778	positive regulation of biological process
GO:0048522	0.734	positive regulation of cellular process
GO:0009893	0.570	positive regulation of metabolic process
GO:0051173	0.555	positive regulation of nitrogen compound metabolic process
GO:0010604	0.554	positive regulation of macromolecule metabolic process
GO:0031325	0.520	positive regulation of cellular metabolic process
GO:0032502	0.474	developmental process
GO:0045935	0.421	positive regulation of nucleobase-containing compound metabolic process
GO:0010557	0.410	positive regulation of macromolecule biosynthetic process
GO:0048519	0.401	negative regulation of biological process
GO:1902680	0.396	positive regulation of RNA biosynthetic process
GO:0045893	0.386	positive regulation of DNA-templated transcription
GO:0048856	0.382	anatomical structure development
GO:0048523	0.374	negative regulation of cellular process
GO:0006357	0.339	regulation of transcription by RNA polymerase II
GO:0050896	0.318	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005737	0.996	cytoplasm
GO:0043232	0.992	intracellular non-membrane-bounded organelle
GO:0032991	0.892	protein-containing complex
GO:0005730	0.710	nucleolus
GO:0005829	0.490	cytosol
GO:0001650	0.449	fibrillar center

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]