StarFunc result for job id Q15345

User Input

>input (812 residues)
MAAPEAWRARSCWFCEVAAATTMEATSREAAPAKSSASGPNAPPALFELCGRAVSAHMGV
LESGVWALPGPILQSILPLLNIYYLERIEETALKKGLSTQAIWRRLWDELMKTRPSSLES
VTCWRAKFMEAFFSHVLRGTIDVSSDRRLCDQRFSPLLHSSRHVRQLTICNMLQGATELV
AEPNRRVLETLASSLHTLKFRHLLFSDVAAQQSLRQLLHQLIHHGAVSQVSLYSWPVPES
ALFILILTMSAGFWQPGPGGPPCRLCGEASRGRAPSRDEGSLLLGSRRPRRDAAERCAAA
LMASRRKSEAKQMPRAAPATRVTRRSTQESLTAGGTDLKRELHPPATSHEAPGTKRSPSA
PAATSSASSSTSSYKRAPASSAPQPKPLKRFKRAAGKKGARTRQGPGAESEDLYDFVFIV
AGEKEDGEEMEIGEVACGALDGSDPSCLGLPALEASQRFRSISTLELFTVPLSTEAALTL
CHLLSSWVSLESLTLSYNGLGSNIFRLLDSLRALSGQAGCRLRALHLSDLFSPLPILELT
RAIVRALPLLRVLSIRVDHPSQRDNPGVPGNAGPPSHIIGDEEIPENCLEQLEMGFPRGA
QPAPLLCSVLKASGSLQQLSLDSATFASPQDFGLVLQTLKEYNLALKRLSFHDMNLADCQ
SEVLFLLQNLTLQEITFSFCRLFEKRPAQFLPEMVAAMKGNSTLKGLRLPGNRLGNAGLL
ALADVFSEDSSSSLCQLDISSNCIKPDGLLEFAKRLERWGRGAFGHLRLFQNWLDQDAVT
AREAIRRLRATCHVVSDSWDSSQAFADYVSTM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15345	1.000	1.000	0.000	812	1.000	1.000	Q15345.pdb.gz	LRC41_HUMAN Leucine-rich repeat-containing protein 41 OS=Homo sapiens OX=9606 GN=LRRC41 PE=1 SV=3
2	AFDB:A8DYA6	0.249	0.300	1.780E-8	651	0.108	0.135	A8DYA6.pdb.gz	A8DYA6_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=Dmel\CG9003 PE=4 SV=1
3	AFDB:Q6F5E8	0.200	0.129	9.109E-7	1435	0.100	0.056	Q6F5E8.pdb.gz	CARL2_HUMAN Capping protein, Arp2/3 and myosin-I linker protein 2 OS=Homo sapiens OX=9606 GN=CARMIL2 PE=1 SV=2
4	PDB:6o60C	0.264	0.506	2.886E-6	389	0.085	0.177	6o60C.pdb.gz	GGTase3 is a newly identified geranylgeranyltransferase targeting a ubiquitin ligase.
5	PDB:3oglB	0.229	0.302	3.466E-6	568	0.070	0.100	3oglB.pdb.gz	Jasmonate perception by inositol-phosphate-potentiated COI1-JAZ co-receptor.
6	PDB:7pmkL	0.259	0.405	6.282E-6	475	0.095	0.162	7pmkL.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
7	PDB:4kxfP	0.286	0.271	9.484E-6	866	0.078	0.073	4kxfP.pdb.gz	Crystal structure of NLRC4 reveals its autoinhibition mechanism
8	PDB:1a4yA	0.265	0.420	9.928E-6	460	0.083	0.146	1a4yA.pdb.gz
9	PDB:7pzcA	0.221	0.184	1.039E-5	1010	0.069	0.055	7pzcA.pdb.gz	Structure of the NLRP3 decamer bound to the cytokine release inhibitor CRID3.
10	PDB:1k5dC	0.285	0.602	3.742E-5	344	0.070	0.166	1k5dC.pdb.gz	RanGAP mediates GTP hydrolysis without an arginine finger.
11	PDB:7sa1B	0.261	0.326	1.122E-4	624	0.064	0.083	7sa1B.pdb.gz
12	PDB:6hkwA	0.217	0.484	1.546E-4	306	0.076	0.203	6hkwA.pdb.gz
13	AFDB:M9NED4	0.212	0.186	2.534E-4	944	0.106	0.091	M9NED4.pdb.gz	M9NED4_DROME Uncharacterized protein, isoform C OS=Drosophila melanogaster OX=7227 GN=Dmel\CG2247 PE=1 SV=1
14	PDB:7lfhA	0.297	0.299	2.934E-4	806	0.076	0.077	7lfhA.pdb.gz
15	AFDB:A2BID5	0.086	0.086	5.356E-2	813	0.063	0.063	A2BID5.pdb.gz	MELT_DANRE Ventricular zone-expressed PH domain-containing protein OS=Danio rerio OX=7955 GN=veph PE=2 SV=1
16	AFDB:Q03468	0.096	0.068	1.064E-1	1493	0.134	0.073	Q03468.pdb.gz	ERCC6_HUMAN DNA excision repair protein ERCC-6 OS=Homo sapiens OX=9606 GN=ERCC6 PE=1 SV=1
17	AFDB:Q1XG89	0.101	0.060	3.048E-1	1759	0.105	0.048	Q1XG89.pdb.gz	TDR12_BOMMO Putative ATP-dependent RNA helicase TDRD12 OS=Bombyx mori OX=7091 GN=TDRD12 PE=1 SV=2
18	AFDB:Q10988	0.107	0.129	4.011E-1	599	0.087	0.119	Q10988.pdb.gz	UVE1_SCHPO UV-damage endonuclease OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=uve1 PE=2 SV=1
19	AFDB:Q9SY69	0.075	0.069	5.525E-1	913	0.068	0.060	Q9SY69.pdb.gz	PPR29_ARATH Pentatricopeptide repeat-containing protein At1g10270 OS=Arabidopsis thaliana OX=3702 GN=GRP23 PE=1 SV=1
20	AFDB:P32744	0.077	0.066	7.270E-1	1020	0.116	0.092	P32744.pdb.gz	CLAS2_CAEEL Protein CLASP-2 OS=Caenorhabditis elegans OX=6239 GN=cls-2 PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q15345	0.0	1640	812	1.000	1.000	LRC41_HUMAN Leucine-rich repeat-containing protein 41 OS=Homo sapiens OX=9606 GN=LRRC41 PE=1 SV=3
2	Q8K1C9	0.0	1535	807	0.946	0.952	LRC41_MOUSE Leucine-rich repeat-containing protein 41 OS=Mus musculus OX=10090 GN=Lrrc41 PE=1 SV=3
3	Q3V3V9	2.52e-04	47.4	1296	0.055	0.035	CARL2_MOUSE Capping protein, Arp2/3 and myosin-I linker protein 2 OS=Mus musculus OX=10090 GN=Carmil2 PE=1 SV=2
4	Q96HA7	7.59e-04	45.8	1378	0.046	0.027	TONSL_HUMAN Tonsoku-like protein OS=Homo sapiens OX=9606 GN=TONSL PE=1 SV=2
5	Q38A18	0.002	44.3	1082	0.059	0.044	Q38A18_TRYB2 Paraflagellar rod component OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.0810 PE=4 SV=1
6	Q21301	0.027	40.4	1056	0.031	0.024	Q21301_CAEEL CARMIL pleckstrin homology domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=crml-1 PE=1 SV=2
7	H3BLT9	0.030	40.4	1112	0.048	0.035	H3BLT9_HUMAN NLR family CARD domain containing 3 OS=Homo sapiens OX=9606 GN=NLRC3 PE=1 SV=2
8	C3VPR7	0.033	40.4	1065	0.048	0.037	C3VPR7_HUMAN NLRC3 OS=Homo sapiens OX=9606 GN=NLRC3 PE=2 SV=1
9	Q7RTR2	0.033	40.4	1065	0.048	0.037	NLRC3_HUMAN NLR family CARD domain-containing protein 3 OS=Homo sapiens OX=9606 GN=NLRC3 PE=1 SV=2
10	Q93ZV8	0.12	38.5	605	0.055	0.074	Q93ZV8_ARATH RNI-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=EMB2004 PE=1 SV=1
11	Q3UWL9	0.17	38.1	944	0.078	0.067	Q3UWL9_MOUSE NACHT, LRR and PYD domains-containing protein 4F OS=Mus musculus OX=10090 GN=Nlrp4g PE=2 SV=1
12	Q8R2K4	0.30	37.0	616	0.041	0.054	TAF6L_MOUSE TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L OS=Mus musculus OX=10090 GN=Taf6l PE=1 SV=1
13	P36159	0.36	37.0	838	0.048	0.047	RNZ_YEAST Ribonuclease Z OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TRZ1 PE=1 SV=1
14	Q5DU56	0.39	37.0	1064	0.074	0.056	NLRC3_MOUSE Protein NLRC3 OS=Mus musculus OX=10090 GN=Nlrc3 PE=1 SV=2
15	Q9NZQ9	0.39	36.2	345	0.030	0.070	TMOD4_HUMAN Tropomodulin-4 OS=Homo sapiens OX=9606 GN=TMOD4 PE=1 SV=1
16	Q66X05	0.53	36.2	959	0.065	0.055	NAL4F_MOUSE NACHT, LRR and PYD domains-containing protein 4F OS=Mus musculus OX=10090 GN=Nlrp4f PE=1 SV=1
17	P9WPD5	0.73	35.8	431	0.065	0.123	CISY1_MYCTU Citrate synthase 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=gltA2 PE=1 SV=1
18	P24394	1.0	35.4	825	0.027	0.027	IL4RA_HUMAN Interleukin-4 receptor subunit alpha OS=Homo sapiens OX=9606 GN=IL4R PE=1 SV=1
19	Q383W7	1.0	35.4	764	0.028	0.030	Q383W7_TRYB2 Leucine-rich repeat protein (LRRP) OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.1380 PE=4 SV=1
20	Q3UP24	1.2	35.0	1024	0.025	0.020	NLRC4_MOUSE NLR family CARD domain-containing protein 4 OS=Mus musculus OX=10090 GN=Nlrc4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13516 LRR_6	0.33	22.2	Leucine Rich repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000477792

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000376808	0.905	Cullin-5
2	9606.ENSP00000262306	0.874	Elongin-B
3	9606.ENSP00000369318	0.831	Rho-related BTB domain-containing protein 3
4	9606.ENSP00000478121	0.811	Elongin-C
5	9606.ENSP00000216225	0.768	E3 ubiquitin-protein ligase RBX1
6	9606.ENSP00000338788	0.724	Zinc finger CCCH domain-containing protein 15
7	9606.ENSP00000273480	0.684	RING-box protein 2
8	9606.ENSP00000250495	0.673	NEDD8
9	9606.ENSP00000267935	0.608	COMM domain-containing protein 4
10	9606.ENSP00000365401	0.602	Coiled-coil domain-containing protein 22
11	9606.ENSP00000366032	0.602	COMM domain-containing protein 3
12	9606.ENSP00000263401	0.600	COMM domain-containing protein 9
13	9606.ENSP00000274458	0.600	COMM domain-containing protein 10
14	9606.ENSP00000278980	0.600	COMM domain-containing protein 7
15	9606.ENSP00000308236	0.600	COMM domain-containing protein 1
16	9606.ENSP00000348054	0.600	COMM domain containing 6
17	9606.ENSP00000370984	0.600	COMM domain-containing protein 8
18	9606.ENSP00000394331	0.600	COMM domain-containing protein 5
19	9606.ENSP00000419475	0.600	COMM domain-containing protein 2
20	9606.ENSP00000330221	0.590	SPRY domain-containing SOCS box protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.977	cellular process
GO:0071704	0.973	organic substance metabolic process
GO:0044238	0.968	primary metabolic process
GO:0065007	0.965	biological regulation
GO:0050789	0.952	regulation of biological process
GO:0006807	0.904	nitrogen compound metabolic process
GO:0043170	0.874	macromolecule metabolic process
GO:0006508	0.788	proteolysis
GO:0050794	0.643	regulation of cellular process
GO:0044237	0.588	cellular metabolic process
GO:0019222	0.456	regulation of metabolic process
GO:0032446	0.429	protein modification by small protein conjugation
GO:0060255	0.411	regulation of macromolecule metabolic process
GO:0051171	0.411	regulation of nitrogen compound metabolic process
GO:0016567	0.393	protein ubiquitination
GO:0080090	0.377	regulation of primary metabolic process
GO:0006511	0.357	ubiquitin-dependent protein catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.997	cytosol
GO:0043229	0.996	intracellular organelle
GO:0005634	0.991	nucleus
GO:0016020	0.963	membrane
GO:0031981	0.790	nuclear lumen
GO:0005654	0.525	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]