StarFunc result for job id Q15361

User Input

>input (905 residues)
MEGESSRFEIHTPVSDKKKKKCSIHKERPQKHSHEIFRDSSLVNEQSQITRRKKRKKDFQ
HLISSPLKKSRICDETANATSTLKKRKKRRYSALEVDEEAGVTVVLVDKENINNTPKHFR
KDVDVVCVDMSIEQKLPRKPKTDKFQVLAKSHAHKSEALHSKVREKKNKKHQRKAASWES
QRARDTLPQSESHQEESWLSVGPGGEITELPASAHKNKSKKKKKKSSNREYETLAMPEGS
QAGREAGTDMQESQPTVGLDDETPQLLGPTHKKKSKKKKKKKSNHQEFEALAMPEGSQVG
SEVGADMQESRPAVGLHGETAGIPAPAYKNKSKKKKKKSNHQEFEAVAMPESLESAYPEG
SQVGSEVGTVEGSTALKGFKESNSTKKKSKKRKLTSVKRARVSGDDFSVPSKNSESTLFD
SVEGDGAMMEEGVKSRPRQKKTQACLASKHVQEAPRLEPANEEHNVETAEDSEIRYLSAD
SGDADDSDADLGSAVKQLQEFIPNIKDRATSTIKRMYRDDLERFKEFKAQGVAIKFGKFS
VKENKQLEKNVEDFLALTGIESADKLLYTDRYPEEKSVITNLKRRYSFRLHIGRNIARPW
KLIYYRAKKMFDVNNYKGRYSEGDTEKLKMYHSLLGNDWKTIGEMVARSSLSVALKFSQI
SSQRNRGAWSKSETRKLIKAVEEVILKKMSPQELKEVDSKLQENPESCLSIVREKLYKGI
SWVEVEAKVQTRNWMQCKSKWTEILTKRMTNGRRIYYGMNALRAKVSLIERLYEINVEDT
NEIDWEDLASAIGDVPPSYVQTKFSRLKAVYVPFWQKKTFPEIIDYLYETTLPLLKEKLE
KMMEKKGTKIQTPAAPKQVFPFRDIFYYEDDSEGEDIEKESEGQAPCMAHACNSSTLGGQ
GRWII

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q63767	0.073	0.069	1.660E-3	968	0.126	0.118	Q63767.pdb.gz	BCAR1_RAT Breast cancer anti-estrogen resistance protein 1 OS=Rattus norvegicus OX=10116 GN=Bcar1 PE=1 SV=1
2	AFDB:A0A1D8PLL4	0.078	0.073	8.529E-3	1027	0.135	0.119	A0A1D8PLL4.pdb.gz	A0A1D8PLL4_CANAL Rgt1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RGT1 PE=4 SV=1
3	AFDB:Q08562	0.066	0.056	8.529E-3	1619	0.131	0.074	Q08562.pdb.gz	ULS1_YEAST ATP-dependent helicase ULS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ULS1 PE=1 SV=1
4	AFDB:E9PR38	0.082	0.080	2.580E-2	944	0.131	0.126	E9PR38.pdb.gz	E9PR38_HUMAN Pumilio RNA binding family member 1 OS=Homo sapiens OX=9606 GN=PUM1 PE=1 SV=1
5	AFDB:P53148	0.055	0.055	7.805E-2	917	0.123	0.121	P53148.pdb.gz	SP105_YEAST Spindle pole body component SPC105 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SPC105 PE=1 SV=1
6	AFDB:Q96D09	0.066	0.068	8.190E-2	838	0.133	0.143	Q96D09.pdb.gz	GASP2_HUMAN G-protein coupled receptor-associated sorting protein 2 OS=Homo sapiens OX=9606 GN=GPRASP2 PE=1 SV=1
7	AFDB:F4IKX0	0.070	0.062	9.018E-2	1108	0.161	0.132	F4IKX0.pdb.gz	F4IKX0_ARATH Heat shock protein DnaJ with tetratricopeptide repeat-containing protein OS=Arabidopsis thaliana OX=3702 GN=TPR15 PE=1 SV=1
8	AFDB:Q587H5	0.057	0.041	1.459E-1	1501	0.119	0.072	Q587H5.pdb.gz	Q587H5_TRYB2 Protein kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=10C8.160 PE=4 SV=1
9	AFDB:Q80U58	0.088	0.078	1.459E-1	1066	0.145	0.123	Q80U58.pdb.gz	PUM2_MOUSE Pumilio homolog 2 OS=Mus musculus OX=10090 GN=Pum2 PE=1 SV=2
10	AFDB:A8DZ29	0.075	0.045	1.531E-1	1919	0.140	0.066	A8DZ29.pdb.gz	A8DZ29_DROME Eukaryotic translation initiation factor 4G1, isoform B OS=Drosophila melanogaster OX=7227 GN=eIF4G1 PE=1 SV=1
11	PDB:5z56L	0.089	0.219	2.142E-1	342	0.056	0.149	5z56L.pdb.gz	Structure of the human activated spliceosome in three conformational states.
12	PDB:6qdvO	0.090	0.173	3.304E-1	441	0.059	0.120	6qdvO.pdb.gz	A human postcatalytic spliceosome structure reveals essential roles of metazoan factors for exon ligation.
13	PDB:6id0L	0.098	0.172	3.638E-1	475	0.060	0.114	6id0L.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
14	PDB:6j6gc	0.086	0.172	5.610E-1	436	0.060	0.124	6j6gc.pdb.gz	Structures of the Catalytically Activated Yeast Spliceosome Reveal the Mechanism of Branching.
15	PDB:3ay5A	0.081	0.163	1.049	298	0.052	0.158	3ay5A.pdb.gz
16	PDB:3jb9W	0.075	0.146	1.049	426	0.044	0.094	3jb9W.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
17	PDB:6tdaL	0.054	0.078	1.100	596	0.056	0.086	6tdaL.pdb.gz	Structure of SWI/SNF chromatin remodeller RSC bound to a nucleosome.
18	PDB:6hivCk	0.071	0.086	1.541	703	0.050	0.064	6hivCk.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
19	PDB:6wq2A	0.062	0.194	1.869	154	0.031	0.182	6wq2A.pdb.gz	Structures of filamentous viruses infecting hyperthermophilic archaea explain DNA stabilization in extreme environments.
20	PDB:2grmA	0.091	0.174	1.961	315	0.048	0.137	2grmA.pdb.gz	Molecular basis for control of conjugation by bacterial pheromone and inhibitor peptides.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q15361	0.0	1868	905	1.000	1.000	TTF1_HUMAN Transcription termination factor 1 OS=Homo sapiens OX=9606 GN=TTF1 PE=1 SV=3
2	Q62187	0.0	683	859	0.373	0.393	TTF1_MOUSE Transcription termination factor 1 OS=Mus musculus OX=10090 GN=Ttf1 PE=1 SV=2
3	E7EPA0	4.76e-23	107	690	0.093	0.122	E7EPA0_HUMAN Cyclin D binding myb like transcription factor 1 OS=Homo sapiens OX=9606 GN=DMTF1 PE=1 SV=1
4	Q9Y222	5.52e-23	107	760	0.093	0.111	DMTF1_HUMAN Cyclin-D-binding Myb-like transcription factor 1 OS=Homo sapiens OX=9606 GN=DMTF1 PE=1 SV=1
5	Q8CE22	1.34e-22	106	761	0.093	0.110	DMTF1_MOUSE Cyclin-D-binding Myb-like transcription factor 1 OS=Mus musculus OX=10090 GN=Dmtf1 PE=1 SV=2
6	J9VW97	1.24e-06	54.7	625	0.077	0.112	LIV4_CRYNH DNA-binding protein LIV4 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=LIV4 PE=4 SV=2
7	Q12457	0.001	44.7	570	0.077	0.123	NSI1_YEAST RNA polymerase I termination factor OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NSI1 PE=1 SV=1
8	Q9UUI6	0.006	42.7	466	0.050	0.097	RTF_SCHPO Replication termination factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rtf1 PE=1 SV=2
9	Q9P6H9	0.038	40.0	504	0.074	0.133	REB1_SCHPO DNA-binding protein reb1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=reb1 PE=1 SV=1
10	B8PYG1	1.1	35.4	570	0.030	0.047	NSMF_DANRE NMDA receptor synaptonuclear signaling and neuronal migration factor OS=Danio rerio OX=7955 GN=nsmf PE=2 SV=1
11	D4A2Z8	4.8	33.5	1000	0.030	0.027	DHX36_RAT ATP-dependent DNA/RNA helicase DHX36 OS=Rattus norvegicus OX=10116 GN=Dhx36 PE=1 SV=1
12	O08815	6.8	33.1	1206	0.083	0.062	SLK_RAT STE20-like serine/threonine-protein kinase OS=Rattus norvegicus OX=10116 GN=Slk PE=1 SV=1
13	O74975	9.9	32.0	362	0.027	0.066	PCY1_SCHPO Probable choline-phosphate cytidylyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC1827.02c PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00249 Myb_DNA-binding	1.8e-07	42.5	Myb-like DNA-binding domain
2	PF13921 Myb_DNA-bind_6	2.3e-07	42.3	Myb-like DNA-binding domain
3	PF09811 Yae1_N	55	14.9	Essential protein Yae1, N terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000333920

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000446880	0.997	Bromodomain adjacent to zinc finger domain protein 2A
2	9606.ENSP00000296417	0.924	Histone H2A.Z
3	9606.ENSP00000316152	0.921	Pulmonary surfactant-associated protein C
4	9606.ENSP00000358151	0.915	Histone H2B type 2-E
5	9606.ENSP00000332194	0.913	Histone H2A type 2-C
6	9606.ENSP00000386346	0.913	Pulmonary surfactant-associated protein B
7	9606.ENSP00000349541	0.911	Caveolae-associated protein 1
8	9606.ENSP00000308405	0.910	Histone H2A.V
9	9606.ENSP00000484261	0.908	Histone H2A-Bbd type 1
10	9606.ENSP00000283131	0.907	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5
11	9606.ENSP00000274764	0.906	Histone H2B type 1-A
12	9606.ENSP00000289316	0.906	Histone H2B type 1-D
13	9606.ENSP00000328484	0.906	Histone H2A type 1-J
14	9606.ENSP00000341094	0.906	Histone H2A type 1-D
15	9606.ENSP00000349430	0.906	Histone H2B type 1-K
16	9606.ENSP00000366618	0.906	Histone H2B type 1-L
17	9606.ENSP00000367022	0.906	Histone H2A type 1-C
18	9606.ENSP00000434024	0.906	Histone H2AX
19	9606.ENSP00000438553	0.906	Histone H2A.J
20	9606.ENSP00000476136	0.906	Histone H2B type 1-J

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003676	0.969	nucleic acid binding
GO:0003677	0.868	DNA binding
GO:0043565	0.570	sequence-specific DNA binding
GO:1990837	0.546	sequence-specific double-stranded DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.995	primary metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0006325	0.989	chromatin organization
GO:0006351	0.989	DNA-templated transcription
GO:0006360	0.966	transcription by RNA polymerase I
GO:0006353	0.947	DNA-templated transcription termination
GO:0006338	0.721	chromatin remodeling
GO:0006352	0.551	DNA-templated transcription initiation
GO:0050789	0.534	regulation of biological process
GO:0050794	0.478	regulation of cellular process
GO:0019222	0.385	regulation of metabolic process
GO:0060255	0.356	regulation of macromolecule metabolic process
GO:0080090	0.331	regulation of primary metabolic process
GO:0051171	0.328	regulation of nitrogen compound metabolic process
GO:0019219	0.316	regulation of nucleobase-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	1.000	nucleoplasm
GO:0005730	1.000	nucleolus
GO:0005886	0.998	plasma membrane
GO:0032991	0.518	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]