StarFunc result for job id Q15363

User Input

>input (201 residues)
MVTLAELLVLLAALLATVSGYFVSIDAHAEECFFERVTSGTKMGLIFEVAEGGFLDIDVE
ITGPDNKGIYKGDRESSGKYTFAAHMDGTYKFCFSNRMSTMTPKIVMFTIDIGEAPKGQD
METEAHQNKLEEMINELAVAMTAVKHEQEYMEVRERIHRAINDNTNSRVVLWSFFEALVL
VAMTLGQIYYLKRFFEVRRVV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15363	1.000	1.000	2.047E-32	201	1.000	1.000	Q15363.pdb.gz	TMED2_HUMAN Transmembrane emp24 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=TMED2 PE=1 SV=1
2	AFDB:O17528	0.803	0.795	1.213E-23	203	0.667	0.660	O17528.pdb.gz	TMED2_CAEEL Suppressor/enhancer of lin-12 protein 9 OS=Caenorhabditis elegans OX=6239 GN=sel-9 PE=1 SV=1
3	AFDB:Q9W4K0	0.647	0.628	6.994E-23	208	0.607	0.587	Q9W4K0.pdb.gz	Q9W4K0_DROME CHOp24, isoform A OS=Drosophila melanogaster OX=7227 GN=CHOp24 PE=1 SV=1
4	AFDB:Q381R2	0.483	0.427	1.185E-16	228	0.353	0.311	Q381R2.pdb.gz	Q381R2_TRYB2 Cytosolic coat protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.6880 PE=3 SV=1
5	AFDB:Q9P7I9	0.559	0.562	2.156E-15	199	0.313	0.317	Q9P7I9.pdb.gz	EMP24_SCHPO Endosomal protein P24B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=emp24 PE=3 SV=1
6	AFDB:Q59V63	0.789	0.793	7.190E-15	200	0.299	0.300	Q59V63.pdb.gz	Q59V63_CANAL Emp24p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=EMP24 PE=3 SV=1
7	AFDB:Q9Y3B3	0.669	0.611	1.387E-14	224	0.348	0.312	Q9Y3B3.pdb.gz	TMED7_HUMAN Transmembrane emp24 domain-containing protein 7 OS=Homo sapiens OX=9606 GN=TMED7 PE=1 SV=2
8	AFDB:P32803	0.580	0.575	3.715E-14	203	0.323	0.320	P32803.pdb.gz	EMP24_YEAST Endosomal protein P24B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EMP24 PE=1 SV=1
9	AFDB:O13770	0.619	0.599	3.924E-14	210	0.254	0.243	O13770.pdb.gz	YE98_SCHPO Uncharacterized membrane protein C17A5.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17A5.08 PE=3 SV=1
10	AFDB:Q6AY25	0.594	0.551	4.378E-14	221	0.303	0.276	Q6AY25.pdb.gz	TMED3_RAT Transmembrane emp24 domain-containing protein 3 OS=Rattus norvegicus OX=10116 GN=Tmed3 PE=1 SV=1
11	PDB:4uybA	0.427	0.223	5.872E-7	401	0.090	0.045	4uybA.pdb.gz
12	PDB:4tlgA	0.415	0.219	2.574E-6	396	0.075	0.038	4tlgA.pdb.gz	Crystal structure of SEC14-like protein 4 (SEC14L4)
13	PDB:1olmE	0.414	0.217	1.656E-5	397	0.090	0.045	1olmE.pdb.gz	Supernatant Protein Factor in Complex with Rrr-Alpha-Tocopherylquinone: A Link between Oxidized Vitamin E and Cholesterol Biosynthesis
14	PDB:4dxzA	0.276	0.457	8.527E-4	111	0.070	0.126	4dxzA.pdb.gz
15	PDB:2waaA	0.267	0.179	4.406E-3	335	0.050	0.030	2waaA.pdb.gz
16	PDB:3lxuX	0.329	0.065	5.484E-3	1217	0.060	0.010	3lxuX.pdb.gz
17	PDB:7bhqB	0.207	0.205	5.484E-3	204	0.100	0.098	7bhqB.pdb.gz
18	PDB:6vlsD	0.348	0.084	6.827E-3	963	0.055	0.011	6vlsD.pdb.gz
19	PDB:5ffoG	0.210	0.154	8.498E-3	297	0.055	0.037	5ffoG.pdb.gz	Force interacts with macromolecular structure in activation of TGF-beta.
20	PDB:1ikpA	0.255	0.113	8.976E-3	599	0.100	0.033	1ikpA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q15363	2.94e-150	416	201	1.000	1.000	TMED2_HUMAN Transmembrane emp24 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=TMED2 PE=1 SV=1
2	Q6FHT8	2.94e-150	416	201	1.000	1.000	Q6FHT8_HUMAN RNP24 protein OS=Homo sapiens OX=9606 GN=RNP24 PE=2 SV=1
3	Q63524	1.12e-149	415	201	0.995	0.995	TMED2_RAT Transmembrane emp24 domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Tmed2 PE=1 SV=1
4	Q9R0Q3	5.27e-149	413	201	0.990	0.990	TMED2_MOUSE Transmembrane emp24 domain-containing protein 2 OS=Mus musculus OX=10090 GN=Tmed2 PE=1 SV=1
5	P49020	3.68e-145	403	196	0.960	0.985	TMED2_CRIGR Transmembrane emp24 domain-containing protein 2 (Fragment) OS=Cricetulus griseus OX=10029 GN=TMED2 PE=1 SV=1
6	E7EQ72	1.93e-113	322	166	0.791	0.958	E7EQ72_HUMAN Transmembrane p24 trafficking protein 2 (Fragment) OS=Homo sapiens OX=9606 GN=TMED2 PE=1 SV=2
7	O17528	8.76e-96	279	203	0.667	0.660	TMED2_CAEEL Suppressor/enhancer of lin-12 protein 9 OS=Caenorhabditis elegans OX=6239 GN=sel-9 PE=1 SV=1
8	Q9W4K0	2.84e-86	255	208	0.582	0.562	Q9W4K0_DROME CHOp24, isoform A OS=Drosophila melanogaster OX=7227 GN=CHOp24 PE=1 SV=1
9	Q381R2	8.30e-38	132	228	0.328	0.289	Q381R2_TRYB2 Cytosolic coat protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.6880 PE=3 SV=1
10	Q9Y3B3	6.57e-35	124	224	0.318	0.286	TMED7_HUMAN Transmembrane emp24 domain-containing protein 7 OS=Homo sapiens OX=9606 GN=TMED7 PE=1 SV=2
11	Q9P7I9	2.12e-33	120	199	0.313	0.317	EMP24_SCHPO Endosomal protein P24B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=emp24 PE=3 SV=1
12	P32803	4.50e-29	109	203	0.333	0.330	EMP24_YEAST Endosomal protein P24B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EMP24 PE=1 SV=1
13	Q59V63	7.09e-27	103	200	0.308	0.310	Q59V63_CANAL Emp24p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=EMP24 PE=3 SV=1
14	A0A140VKD1	1.36e-26	103	217	0.284	0.263	A0A140VKD1_HUMAN Testis tissue sperm-binding protein Li 48e OS=Homo sapiens OX=9606 GN=TMED3 PE=2 SV=1
15	Q9Y3Q3	1.36e-26	103	217	0.284	0.263	TMED3_HUMAN Transmembrane emp24 domain-containing protein 3 OS=Homo sapiens OX=9606 GN=TMED3 PE=1 SV=1
16	Q6AY25	3.76e-25	99.4	221	0.279	0.253	TMED3_RAT Transmembrane emp24 domain-containing protein 3 OS=Rattus norvegicus OX=10116 GN=Tmed3 PE=1 SV=1
17	O13770	2.74e-21	89.0	210	0.249	0.238	YE98_SCHPO Uncharacterized membrane protein C17A5.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17A5.08 PE=3 SV=1
18	Q9I7K5	5.08e-20	85.9	216	0.289	0.269	TMEDE_DROME Transmembrane emp24 domain-containing protein eca OS=Drosophila melanogaster OX=7227 GN=eca PE=2 SV=2
19	Q9BVK6	6.05e-20	86.3	235	0.299	0.255	TMED9_HUMAN Transmembrane emp24 domain-containing protein 9 OS=Homo sapiens OX=9606 GN=TMED9 PE=1 SV=2
20	Q9LIL4	9.36e-20	85.1	214	0.289	0.271	P24B3_ARATH Transmembrane emp24 domain-containing protein p24beta3 OS=Arabidopsis thaliana OX=3702 GN=At3g22845 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01105 EMP24_GP25L	3.7e-46	168.9	emp24/gp25L/p24 family/GOLD
2	PF17210 SdrD_B	54	15.4	SdrD B-like domain
3	PF02342 TerD	6.1	17.8	TerD domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 482537.XP_008589583.1

Rank	PPI partner	STRING score	Description
1	482537.XP_008589342.1	0.998	Transmembrane emp24 domain-containing protein 10
2	482537.XP_008590124.1	0.969	Transmembrane emp24 domain-containing protein 4
3	482537.XP_008569124.1	0.967	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 8 mRNAs, 19 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
4	482537.XP_008567497.1	0.958	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 mRNAs, 5 Proteins, and 67% coverage of the annotated genomic feature by RNAseq alignments
5	482537.XP_008563286.1	0.932	Transmembrane emp24 domain-containing protein 3-like
6	482537.XP_008566104.1	0.876	Transmembrane emp24 domain-containing protein 6
7	482537.XP_008589187.1	0.871	Transmembrane emp24 domain-containing protein 7 isoform X1
8	482537.XP_008588618.1	0.867	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 mRNAs, 67 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
9	482537.XP_008587479.1	0.864	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 10 mRNAs, 11 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
10	482537.XP_008578403.1	0.861	Protein ERGIC-53
11	482537.XP_008571788.1	0.854	Transmembrane emp24 domain-containing protein 3
12	482537.XP_008573153.1	0.827	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 8 mRNAs, 15 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
13	482537.XP_008583587.1	0.813	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 27 Proteins, and 98% coverage of the annotated genomic feature by RNAseq alignments
14	482537.XP_008587571.1	0.813	Protein transport protein Sec23A
15	482537.XP_008578891.1	0.808	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 8 mRNAs, 14 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
16	482537.XP_008582226.1	0.804	Prolactin regulatory element-binding protein
17	482537.XP_008589236.1	0.800	Protein transport protein Sec23A
18	482537.XP_008586783.1	0.768	Protein ERGIC-53-like
19	482537.XP_008576418.1	0.765	Vesicular integral-membrane protein VIP36
20	482537.XP_008570974.1	0.755	Golgi phosphoprotein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0051641	0.988	cellular localization
GO:0006810	0.975	transport
GO:0016043	0.926	cellular component organization
GO:0065007	0.878	biological regulation
GO:0010256	0.841	endomembrane system organization
GO:0033036	0.835	macromolecule localization
GO:0006996	0.799	organelle organization
GO:0016192	0.758	vesicle-mediated transport
GO:0051649	0.729	establishment of localization in cell
GO:0050789	0.708	regulation of biological process
GO:0048193	0.670	Golgi vesicle transport
GO:0070727	0.645	cellular macromolecule localization
GO:0008104	0.601	protein localization
GO:0046907	0.583	intracellular transport
GO:0061024	0.536	membrane organization
GO:0050794	0.433	regulation of cellular process
GO:0045184	0.421	establishment of protein localization
GO:0071702	0.387	organic substance transport
GO:0071705	0.355	nitrogen compound transport
GO:0015031	0.352	protein transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	0.999	endomembrane system
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0031090	0.995	organelle membrane
GO:0031982	0.960	vesicle
GO:0030135	0.954	coated vesicle
GO:0005783	0.913	endoplasmic reticulum
GO:0000139	0.901	Golgi membrane
GO:0098827	0.886	endoplasmic reticulum subcompartment
GO:0042175	0.878	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0005789	0.870	endoplasmic reticulum membrane
GO:0030133	0.783	transport vesicle
GO:0005793	0.673	endoplasmic reticulum-Golgi intermediate compartment
GO:0030659	0.668	cytoplasmic vesicle membrane
GO:0005798	0.651	Golgi-associated vesicle
GO:0030137	0.642	COPI-coated vesicle
GO:0032991	0.378	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]