StarFunc result for job id Q15366

User Input

>input (365 residues)
MDTGVIEGGLNVTLTIRLLMHGKEVGSIIGKKGESVKKMREESGARINISEGNCPERIIT
LAGPTNAIFKAFAMIIDKLEEDISSSMTNSTAASRPPVTLRLVVPASQCGSLIGKGGCKI
KEIRESTGAQVQVAGDMLPNSTERAITIAGIPQSIIECVKQICVVMLETLSQSPPKGVTI
PYRPKPSSSPVIFAGGQDRYSTGSDSASFPHTTPSMCLNPDLEGPPLEAYTIQGQYAIPQ
PDLTKLHQLAMQQSHFPMTHGNTGFSGIESSSPEVKGYWGLDASAQTTSHELTIPNDLIG
CIIGRQGAKINEIRQMSGAQIKIANPVEGSTDRQVTITGSAASISLAQYLINVRLSSETG
GMGSS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A384N6B9	0.538	0.537	4.143E-66	366	1.000	0.997	A0A384N6B9.pdb.gz	A0A384N6B9_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=2 SV=1
2	AFDB:Q4V8F6	0.589	0.637	3.605E-59	335	0.915	0.997	Q4V8F6.pdb.gz	Q4V8F6_RAT Pcbp2 protein OS=Rattus norvegicus OX=10116 GN=Pcbp2 PE=1 SV=1
3	AFDB:I3LEC2	0.604	0.619	2.588E-57	356	0.808	0.829	I3LEC2.pdb.gz
4	AFDB:Q7ZVK5	0.540	0.614	2.079E-54	318	0.778	0.893	Q7ZVK5.pdb.gz	Q7ZVK5_DANRE Pcbp2 protein OS=Danio rerio OX=7955 GN=PCBP2 PE=1 SV=1
5	AFDB:P57721	0.540	0.531	8.992E-52	371	0.721	0.709	P57721.pdb.gz	PCBP3_HUMAN Poly(rC)-binding protein 3 OS=Homo sapiens OX=9606 GN=PCBP3 PE=1 SV=2
6	AFDB:A0A024R2Y0	0.532	0.487	1.513E-42	403	0.537	0.486	A0A024R2Y0.pdb.gz
7	AFDB:M9NEH9	0.517	0.338	6.471E-39	573	0.499	0.318	M9NEH9.pdb.gz	M9NEH9_DROME Mushroom-body expressed, isoform K OS=Drosophila melanogaster OX=7227 GN=mub PE=1 SV=1
8	AFDB:P61978	0.413	0.329	3.610E-31	463	0.321	0.253	P61978.pdb.gz	HNRPK_HUMAN Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK PE=1 SV=1
9	AFDB:Q9GZT1	0.486	0.428	9.619E-30	424	0.452	0.389	Q9GZT1.pdb.gz	Q9GZT1_HUMAN Poly(RC) binding protein 4, isoform CRA_a OS=Homo sapiens OX=9606 GN=PCBP4 PE=2 SV=1
10	AFDB:P38151	0.502	0.451	1.219E-28	413	0.238	0.211	P38151.pdb.gz	PBP2_YEAST PAB1-binding protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PBP2 PE=1 SV=1
11	PDB:7mqaSW	0.160	0.265	7.372E-4	195	0.060	0.113	7mqaSW.pdb.gz	Nucleolar maturation of the human small subunit processome.
12	PDB:5it0A	0.138	0.129	1.210E-3	396	0.047	0.043	5it0A.pdb.gz	SAD phasing using iodide ions in a high-throughput structural genomics environment.
13	PDB:7ajuJJ	0.155	0.271	2.113E-3	199	0.052	0.095	7ajuJJ.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
14	PDB:6ofsA	0.154	0.073	4.176E-3	905	0.085	0.034	6ofsA.pdb.gz	Protease-associated import systems are widespread in Gram-negative bacteria.
15	PDB:7mq8NY	0.141	0.177	5.028E-3	274	0.077	0.102	7mq8NY.pdb.gz	Nucleolar maturation of the human small subunit processome.
16	PDB:3i82A	0.164	0.255	5.691E-3	216	0.074	0.125	3i82A.pdb.gz
17	PDB:6n7pG	0.222	0.309	6.055E-3	239	0.041	0.063	6n7pG.pdb.gz	A unified mechanism for intron and exon definition and back-splicing.
18	PDB:6ke6RC	0.132	0.163	8.780E-3	278	0.068	0.090	6ke6RC.pdb.gz	3.4 angstrom cryo-EM structure of yeast 90S small subunit preribosome
19	PDB:1mowA	0.172	0.208	1.197E-2	248	0.058	0.085	1mowA.pdb.gz	Design, Activity and Structure of a Highly Specific Artificial Endonuclease
20	PDB:4iofB	0.150	0.073	1.197E-2	861	0.068	0.029	4iofB.pdb.gz	Conformational states and recognition of amyloidogenic peptides of human insulin-degrading enzyme.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2KBC5	0.0	610	338	0.866	0.935	A0A0G2KBC5_RAT Poly(rC) binding protein 2 OS=Rattus norvegicus OX=10116 GN=Pcbp2 PE=1 SV=1
2	A0A384N6B9	0.0	738	366	1.000	0.997	A0A384N6B9_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=2 SV=1
3	A0A8I5ZZC0	0.0	609	316	0.866	1.000	A0A8I5ZZC0_RAT Poly(rC) binding protein 2 OS=Rattus norvegicus OX=10116 GN=Pcbp2 PE=1 SV=1
4	A0A8I6AGT9	0.0	692	349	0.953	0.997	A0A8I6AGT9_RAT Poly(rC) binding protein 2 OS=Rattus norvegicus OX=10116 GN=Pcbp2 PE=4 SV=1
5	A0A8I6AP00	0.0	641	331	0.904	0.997	A0A8I6AP00_RAT Poly(rC) binding protein 2 OS=Rattus norvegicus OX=10116 GN=Pcbp2 PE=4 SV=1
6	A0A8I6APK5	0.0	536	274	0.723	0.964	A0A8I6APK5_RAT Poly(rC) binding protein 2 OS=Rattus norvegicus OX=10116 GN=Pcbp2 PE=1 SV=1
7	P60335	0.0	588	356	0.830	0.851	PCBP1_MOUSE Poly(rC)-binding protein 1 OS=Mus musculus OX=10090 GN=Pcbp1 PE=1 SV=1
8	Q15365	0.0	588	356	0.830	0.851	PCBP1_HUMAN Poly(rC)-binding protein 1 OS=Homo sapiens OX=9606 GN=PCBP1 PE=1 SV=2
9	Q15366	0.0	742	365	1.000	1.000	PCBP2_HUMAN Poly(rC)-binding protein 2 OS=Homo sapiens OX=9606 GN=PCBP2 PE=1 SV=1
10	Q4V8F6	0.0	654	335	0.915	0.997	Q4V8F6_RAT Pcbp2 protein OS=Rattus norvegicus OX=10116 GN=Pcbp2 PE=1 SV=1
11	Q53SS8	0.0	588	356	0.830	0.851	Q53SS8_HUMAN Epididymis secretory protein Li 85 OS=Homo sapiens OX=9606 GN=PCBP1 PE=2 SV=1
12	Q61990	0.0	724	362	0.989	0.997	PCBP2_MOUSE Poly(rC)-binding protein 2 OS=Mus musculus OX=10090 GN=Pcbp2 PE=1 SV=1
13	Q6AYU2	0.0	724	362	0.989	0.997	Q6AYU2_RAT Poly(rC) binding protein 2 OS=Rattus norvegicus OX=10116 GN=Pcbp2 PE=4 SV=1
14	Q6AYU5	0.0	742	365	1.000	1.000	Q6AYU5_RAT Poly(RC) binding protein 2 OS=Rattus norvegicus OX=10116 GN=Pcbp2 PE=1 SV=1
15	Q7ZVK5	0.0	546	318	0.778	0.893	Q7ZVK5_DANRE Pcbp2 protein OS=Danio rerio OX=7955 GN=PCBP2 PE=1 SV=1
16	P57721	1.01e-175	494	371	0.721	0.709	PCBP3_HUMAN Poly(rC)-binding protein 3 OS=Homo sapiens OX=9606 GN=PCBP3 PE=1 SV=2
17	P57722	1.47e-175	494	371	0.721	0.709	PCBP3_MOUSE Poly(rC)-binding protein 3 OS=Mus musculus OX=10090 GN=Pcbp3 PE=1 SV=3
18	H3BSS4	1.03e-126	363	184	0.493	0.978	H3BSS4_HUMAN Poly(rC) binding protein 2 (Fragment) OS=Homo sapiens OX=9606 GN=PCBP2 PE=1 SV=1
19	C9J0A4	2.27e-120	352	323	0.518	0.585	C9J0A4_HUMAN Poly(rC) binding protein 4 OS=Homo sapiens OX=9606 GN=PCBP4 PE=1 SV=1
20	P57724	5.52e-120	354	403	0.529	0.479	PCBP4_MOUSE Poly(rC)-binding protein 4 OS=Mus musculus OX=10090 GN=Pcbp4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02043 Bac_chlorC	4.2e+02	12.4	Bacteriochlorophyll C binding protein
2	PF00013 KH_1	6.6e-46	165.3	KH domain
3	PF07650 KH_2	7.8e-11	53.0	KH domain
4	PF13083 KH_4	0.00077	30.6	KH domain
5	PF13184 KH_5	0.59	21.6	NusA-like KH domain
6	PF16005 MOEP19	8.1	17.8	KH-like RNA-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010372202.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010379242.1	0.973	Heterogeneous nuclear ribonucleoprotein L isoform X1
2	61622.XP_010362558.1	0.971	poly(rC)-binding protein 1
3	61622.XP_010373232.1	0.896	Polypyrimidine tract-binding protein 1 isoform X1
4	61622.XP_010387995.1	0.894	Serine and arginine rich splicing factor 3
5	61622.XP_010384797.1	0.886	E3 ubiquitin-protein ligase Itchy homolog isoform X1
6	61622.XP_010357733.1	0.861	poly(rC)-binding protein 1-like
7	61622.XP_010357220.1	0.822	Heterogeneous nuclear ribonucleoprotein D0 isoform X1
8	61622.XP_010372253.1	0.820	Eukaryotic translation initiation factor 4B isoform X1
9	61622.XP_010353038.1	0.818	CCHC-type zinc finger nucleic acid binding protein
10	61622.XP_010354836.1	0.812	Heterogeneous nuclear ribonucleoprotein A2/B1
11	61622.XP_010354075.1	0.787	Heterogeneous nuclear ribonucleoprotein R isoform X1
12	61622.XP_010382274.1	0.783	Synaptotagmin binding cytoplasmic RNA interacting protein
13	61622.XP_010362430.1	0.780	Heterogeneous nuclear ribonucleoprotein L like
14	61622.XP_010380701.1	0.774	Heterogeneous nuclear ribonucleoprotein A3
15	61622.XP_010383342.1	0.772	Belongs to the RRM elav family.
16	61622.XP_010352005.1	0.760	Belongs to the helicase family. Dicer subfamily.
17	61622.XP_010387599.1	0.760	pre-mRNA-processing factor 39 isoform X1
18	61622.XP_010377253.1	0.752	Mitochondrial antiviral-signaling protein isoform X1
19	61622.XP_010379281.1	0.748	Heterogeneous nuclear ribonucleoprotein H isoform X1
20	61622.XP_010354187.1	0.741	Heterogeneous nuclear ribonucleoprotein C (C1/C2)

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0003729	0.993	mRNA binding
GO:0003730	0.865	mRNA 3'-UTR binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0050794	0.982	regulation of cellular process
GO:0009987	0.949	cellular process
GO:0048518	0.937	positive regulation of biological process
GO:0060255	0.930	regulation of macromolecule metabolic process
GO:0051171	0.921	regulation of nitrogen compound metabolic process
GO:0080090	0.919	regulation of primary metabolic process
GO:0010468	0.918	regulation of gene expression
GO:0031323	0.905	regulation of cellular metabolic process
GO:0019219	0.893	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.858	regulation of RNA metabolic process
GO:0009893	0.846	positive regulation of metabolic process
GO:0048522	0.823	positive regulation of cellular process
GO:0051173	0.821	positive regulation of nitrogen compound metabolic process
GO:0031325	0.772	positive regulation of cellular metabolic process
GO:0010604	0.762	positive regulation of macromolecule metabolic process
GO:0009889	0.718	regulation of biosynthetic process
GO:0010556	0.703	regulation of macromolecule biosynthetic process
GO:0031326	0.703	regulation of cellular biosynthetic process
GO:0008152	0.681	metabolic process
GO:0045935	0.640	positive regulation of nucleobase-containing compound metabolic process
GO:0006807	0.624	nitrogen compound metabolic process
GO:0044237	0.549	cellular metabolic process
GO:0006357	0.533	regulation of transcription by RNA polymerase II
GO:0044238	0.495	primary metabolic process
GO:0048519	0.495	negative regulation of biological process
GO:0071704	0.466	organic substance metabolic process
GO:0009891	0.436	positive regulation of biosynthetic process
GO:0048523	0.432	negative regulation of cellular process
GO:0043170	0.387	macromolecule metabolic process
GO:0034641	0.375	cellular nitrogen compound metabolic process
GO:0006725	0.369	cellular aromatic compound metabolic process
GO:1901360	0.366	organic cyclic compound metabolic process
GO:0046483	0.338	heterocycle metabolic process
GO:0090304	0.330	nucleic acid metabolic process
GO:0010605	0.311	negative regulation of macromolecule metabolic process
GO:0050896	0.307	response to stimulus
GO:0051172	0.301	negative regulation of nitrogen compound metabolic process
GO:0031324	0.300	negative regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043226	0.999	organelle
GO:0030054	0.995	cell junction
GO:0045202	0.986	synapse
GO:0098794	0.981	postsynapse
GO:0099572	0.967	postsynaptic specialization
GO:0005634	0.963	nucleus
GO:0014069	0.962	postsynaptic density
GO:0005737	0.761	cytoplasm
GO:0005829	0.548	cytosol
GO:0043233	0.419	organelle lumen
GO:0070013	0.393	intracellular organelle lumen
GO:0031981	0.361	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]