StarFunc result for job id Q15369

User Input

>input (112 residues)
MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEV
NFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7JWD6	0.953	0.913	1.879E-21	117	0.920	0.880	Q7JWD6.pdb.gz	Q7JWD6_DROME Elongin-C OS=Drosophila melanogaster OX=7227 GN=EloC PE=1 SV=1
2	PDB:6r7fQ	0.846	0.846	3.005E-18	112	1.000	1.000	6r7fQ.pdb.gz
3	AFDB:Q9BKS1	0.944	0.855	1.285E-17	124	0.741	0.669	Q9BKS1.pdb.gz	Q9BKS1_CAEEL Elongin-C OS=Caenorhabditis elegans OX=6239 GN=elc-1 PE=1 SV=1
4	AFDB:Q9USX9	0.772	0.887	1.905E-11	97	0.402	0.464	Q9USX9.pdb.gz	ELOC_SCHPO Elongin-C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=elc1 PE=3 SV=1
5	AFDB:Q03071	0.764	0.860	6.428E-10	99	0.339	0.384	Q03071.pdb.gz	ELOC_YEAST Elongin-C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ELC1 PE=1 SV=1
6	AFDB:Q384S2	0.758	0.635	3.944E-8	136	0.304	0.250	Q384S2.pdb.gz	Q384S2_TRYB2 Elongin-C OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.5330 PE=3 SV=1
7	PDB:1hv2A	0.676	0.754	9.419E-8	99	0.321	0.364	1hv2A.pdb.gz	Solution structure and dynamics of yeast elongin C in complex with a von Hippel-Lindau peptide.
8	PDB:5zb2B	0.650	0.926	5.657E-7	78	0.259	0.372	5zb2B.pdb.gz	Crystal structure of the yeast Rad7-Elc1 complex and assembly of the Rad7-Rad16-Elc1-Cul3 complex.
9	AFDB:Q9Y709	0.669	0.478	2.419E-6	161	0.295	0.205	Q9Y709.pdb.gz	SKP1_SCHPO Suppressor of kinetochore protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=skp1 PE=1 SV=1
10	AFDB:O77430	0.676	0.480	2.585E-6	162	0.304	0.210	O77430.pdb.gz	O77430_DROME GEO01111p1 OS=Drosophila melanogaster OX=7227 GN=SkpA PE=1 SV=1
11	AFDB:G5EE67	0.674	0.467	7.994E-6	167	0.223	0.150	G5EE67.pdb.gz	G5EE67_CAEEL Skp1-related protein OS=Caenorhabditis elegans OX=6239 GN=skr-3 PE=1 SV=1
12	PDB:5xylA	0.658	0.471	8.606E-6	163	0.286	0.196	5xylA.pdb.gz
13	AFDB:P63208	0.666	0.471	1.272E-5	163	0.295	0.202	P63208.pdb.gz	SKP1_HUMAN S-phase kinase-associated protein 1 OS=Homo sapiens OX=9606 GN=SKP1 PE=1 SV=2
14	AFDB:Q9C5T5	0.666	0.463	1.360E-5	166	0.277	0.187	Q9C5T5.pdb.gz	Q9C5T5_ARATH SKP1-like protein ASK10 (Fragment) OS=Arabidopsis thaliana OX=3702 GN=ASK10 PE=1 SV=1
15	PDB:5vztA	0.620	0.489	4.526E-5	145	0.286	0.221	5vztA.pdb.gz	Structural basis of the phosphorylation-independent recognition of cyclin D1 by the SCFFBXO31 ubiquitin ligase.
16	PDB:3ogkA	0.681	0.536	4.837E-5	145	0.268	0.207	3ogkA.pdb.gz	Jasmonate perception by inositol-phosphate-potentiated COI1-JAZ co-receptor.
17	PDB:7pmkK	0.552	0.462	1.147E-4	137	0.205	0.168	7pmkK.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
18	PDB:6gypD	0.624	0.471	2.084E-4	151	0.232	0.172	6gypD.pdb.gz	Architecture of the CBF3-centromere complex of the budding yeast kinetochore.
19	PDB:2p1nD	0.574	0.509	2.227E-4	127	0.241	0.213	2p1nD.pdb.gz	Mechanism of auxin perception by the TIR1 ubiquitin ligase
20	PDB:7mk2A	0.529	0.193	1.945E-1	354	0.179	0.056	7mk2A.pdb.gz	Structural basis of NPR1 in activating plant immunity.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P83940	4.11e-81	234	112	1.000	1.000	ELOC_MOUSE Elongin-C OS=Mus musculus OX=10090 GN=Eloc PE=1 SV=1
2	P83941	4.11e-81	234	112	1.000	1.000	ELOC_RAT Elongin-C OS=Rattus norvegicus OX=10116 GN=Eloc PE=1 SV=1
3	Q15369	4.11e-81	234	112	1.000	1.000	ELOC_HUMAN Elongin-C OS=Homo sapiens OX=9606 GN=ELOC PE=1 SV=1
4	Q6PHW7	4.11e-81	234	112	1.000	1.000	Q6PHW7_XENLA Elongin-C OS=Xenopus laevis OX=8355 GN=eloc.L PE=1 SV=1
5	Q7JWD6	6.14e-74	216	117	0.902	0.863	Q7JWD6_DROME Elongin-C OS=Drosophila melanogaster OX=7227 GN=EloC PE=1 SV=1
6	Q7KYI0	9.97e-67	197	98	0.830	0.949	Q7KYI0_DROME Elongin-C (Fragment) OS=Drosophila melanogaster OX=7227 GN=EloC PE=2 SV=1
7	Q9BKS1	9.80e-60	181	124	0.741	0.669	Q9BKS1_CAEEL Elongin-C OS=Caenorhabditis elegans OX=6239 GN=elc-1 PE=1 SV=1
8	Q9USX9	1.33e-21	83.6	97	0.402	0.464	ELOC_SCHPO Elongin-C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=elc1 PE=3 SV=1
9	Q03071	6.10e-17	72.0	99	0.339	0.384	ELOC_YEAST Elongin-C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ELC1 PE=1 SV=1
10	Q384S2	2.76e-10	55.8	136	0.295	0.243	Q384S2_TRYB2 Elongin-C OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.5330 PE=3 SV=1
11	P63208	7.89e-05	41.6	163	0.295	0.202	SKP1_HUMAN S-phase kinase-associated protein 1 OS=Homo sapiens OX=9606 GN=SKP1 PE=1 SV=2
12	Q6PEC4	7.89e-05	41.6	163	0.295	0.202	SKP1_RAT S-phase kinase-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Skp1 PE=1 SV=3
13	Q71U00	7.89e-05	41.6	163	0.295	0.202	SKP1_XENLA S-phase kinase-associated protein 1 OS=Xenopus laevis OX=8355 GN=skp1 PE=1 SV=3
14	Q9WTX5	7.89e-05	41.6	163	0.295	0.202	SKP1_MOUSE S-phase kinase-associated protein 1 OS=Mus musculus OX=10090 GN=Skp1 PE=1 SV=3
15	Q9Y709	0.004	37.0	161	0.286	0.199	SKP1_SCHPO Suppressor of kinetochore protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=skp1 PE=1 SV=1
16	Q4WTT8	0.029	34.7	158	0.304	0.215	SKP1_ASPFU E3 ubiquitin ligase complex SCF subunit sconC OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=sconC PE=3 SV=1
17	G5EE67	0.033	34.3	167	0.241	0.162	G5EE67_CAEEL Skp1-related protein OS=Caenorhabditis elegans OX=6239 GN=skr-3 PE=1 SV=1
18	O77430	0.11	33.1	162	0.286	0.198	O77430_DROME GEO01111p1 OS=Drosophila melanogaster OX=7227 GN=SkpA PE=1 SV=1
19	P52285	0.60	30.8	162	0.259	0.179	SKP1A_DICDI SCF ubiquitin ligase complex protein SKP1a OS=Dictyostelium discoideum OX=44689 GN=fpaA PE=1 SV=1
20	Q5BAX8	0.68	30.8	161	0.250	0.174	SKP1_EMENI E3 ubiquitin ligase complex SCF subunit sconC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=sconC PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03931 Skp1_POZ	1.1e-07	43.3	Skp1 family, tetramerisation domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1026970.XP_008847118.1

Rank	PPI partner	STRING score	Description
1	1026970.XP_008827933.1	0.999	Cullin 5
2	1026970.XP_008832077.1	0.999	Cullin-2
3	1026970.XP_008843842.1	0.999	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 15 mRNAs, 5 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 8 samples with support for all annotated introns
4	1026970.XP_008853092.1	0.999	Von Hippel-Lindau disease tumor suppressor isoform X1
5	1026970.XP_008843039.1	0.998	Ring-box 1
6	1026970.XP_008848727.1	0.998	Hypoxia-inducible factor 1-alpha isoform X1
7	1026970.XP_008821989.1	0.992	Suppressor of cytokine signaling 2
8	1026970.XP_008849096.1	0.991	RING-box protein 2 isoform X1
9	1026970.XP_008839115.1	0.990	Ankyrin repeat and SOCS box containing 9
10	1026970.XP_008838027.1	0.988	Neural precursor cell expressed, developmentally down-regulated 8
11	1026970.XP_008847864.1	0.988	Suppressor of cytokine signaling 3
12	1026970.XP_008828148.1	0.985	Suppressor of cytokine signaling 1
13	1026970.XP_008836748.1	0.984	UBX domain-containing protein 7
14	1026970.XP_008824154.1	0.974	Transcription elongation factor B polypeptide 3-like
15	1026970.XP_008846817.1	0.974	Transcription elongation factor B polypeptide 3
16	1026970.XP_008821290.1	0.972	Endothelial PAS domain-containing protein 1
17	1026970.XP_008837762.1	0.969	Suppressor of cytokine signaling 4
18	1026970.XP_008823153.1	0.948	Suppressor of cytokine signaling 6
19	1026970.XP_008837338.1	0.948	Core-binding factor subunit beta isoform X1
20	1026970.XP_008851319.1	0.933	Cytokine-inducible SH2-containing protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.535	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0044238	0.987	primary metabolic process
GO:0006807	0.986	nitrogen compound metabolic process
GO:0050794	0.986	regulation of cellular process
GO:0043170	0.985	macromolecule metabolic process
GO:0044237	0.980	cellular metabolic process
GO:0019222	0.978	regulation of metabolic process
GO:0006351	0.973	DNA-templated transcription
GO:0060255	0.970	regulation of macromolecule metabolic process
GO:0080090	0.965	regulation of primary metabolic process
GO:0051171	0.963	regulation of nitrogen compound metabolic process
GO:0031323	0.957	regulation of cellular metabolic process
GO:0006366	0.944	transcription by RNA polymerase II
GO:0010468	0.916	regulation of gene expression
GO:0009889	0.914	regulation of biosynthetic process
GO:0019219	0.901	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.889	regulation of macromolecule biosynthetic process
GO:0031326	0.889	regulation of cellular biosynthetic process
GO:0051252	0.888	regulation of RNA metabolic process
GO:2001141	0.879	regulation of RNA biosynthetic process
GO:0006355	0.854	regulation of DNA-templated transcription
GO:0032784	0.825	regulation of DNA-templated transcription elongation
GO:0034243	0.823	regulation of transcription elongation by RNA polymerase II
GO:0048518	0.766	positive regulation of biological process
GO:0032786	0.735	positive regulation of DNA-templated transcription, elongation
GO:0006357	0.691	regulation of transcription by RNA polymerase II
GO:0032968	0.673	positive regulation of transcription elongation by RNA polymerase II
GO:0019538	0.585	protein metabolic process
GO:0043412	0.449	macromolecule modification
GO:0032502	0.435	developmental process
GO:0048856	0.434	anatomical structure development
GO:0032501	0.400	multicellular organismal process
GO:0048519	0.394	negative regulation of biological process
GO:0048523	0.368	negative regulation of cellular process
GO:0006352	0.356	DNA-templated transcription initiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005737	0.999	cytoplasm
GO:0140535	0.998	intracellular protein-containing complex
GO:1990234	0.997	transferase complex
GO:0140513	0.994	nuclear protein-containing complex
GO:0000151	0.981	ubiquitin ligase complex
GO:0005829	0.978	cytosol
GO:0031461	0.929	cullin-RING ubiquitin ligase complex
GO:0008023	0.929	transcription elongation factor complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]