StarFunc result for job id Q15370

User Input

>input (118 residues)
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEC
GFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P62869	0.986	0.986	1.826E-22	118	0.975	0.975	P62869.pdb.gz	ELOB_MOUSE Elongin-B OS=Mus musculus OX=10090 GN=Elob PE=1 SV=1
2	PDB:2jz3B	0.721	0.721	1.274E-16	118	1.000	1.000	2jz3B.pdb.gz	The SOCS box domain of SOCS3: structure and interaction with the elonginBC-cullin5 ubiquitin ligase
3	AFDB:O44226	0.886	0.886	1.183E-15	118	0.551	0.551	O44226.pdb.gz	O44226_DROME Elongin B OS=Drosophila melanogaster OX=7227 GN=EloB PE=1 SV=1
4	AFDB:G5ECR7	0.794	0.794	2.706E-11	118	0.390	0.390	G5ECR7.pdb.gz	G5ECR7_CAEEL RNA polymerase II transcription factor SIII p18 subunit OS=Caenorhabditis elegans OX=6239 GN=elb-1 PE=1 SV=1
5	AFDB:Q8L8S0	0.684	0.842	9.423E-8	95	0.212	0.263	Q8L8S0.pdb.gz	Q8L8S0_ARATH At5g57860 OS=Arabidopsis thaliana OX=3702 GN=MTI20.11 PE=1 SV=1
6	PDB:3zkjC	0.561	0.939	1.604E-7	70	0.568	0.957	3zkjC.pdb.gz
7	AFDB:Q585Z0	0.576	0.431	1.399E-6	159	0.220	0.164	Q585Z0.pdb.gz	Q585Z0_TRYB2 Ubiquitin-like domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.4F7.480 PE=4 SV=1
8	AFDB:P59232	0.596	0.452	2.311E-6	157	0.178	0.134	P59232.pdb.gz	R27AB_ARATH Ubiquitin-ribosomal protein eS31y fusion protein OS=Arabidopsis thaliana OX=3702 GN=RPS27AB PE=2 SV=2
9	AFDB:P15357	0.594	0.453	5.921E-6	156	0.186	0.141	P15357.pdb.gz	RS27A_DROME Ubiquitin-ribosomal protein eS31 fusion protein OS=Drosophila melanogaster OX=7227 GN=RpS27A PE=1 SV=2
10	AFDB:Q5A109	0.604	0.376	6.713E-6	193	0.169	0.104	Q5A109.pdb.gz	RS31_CANAL Ubiquitin-ribosomal protein eS31 fusion protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=UBI3 PE=1 SV=2
11	AFDB:P49632	0.588	0.543	1.338E-5	128	0.186	0.172	P49632.pdb.gz	RL40_CAEEL Ubiquitin-ribosomal protein eL40 fusion protein OS=Caenorhabditis elegans OX=6239 GN=ubq-2 PE=3 SV=2
12	PDB:6yvaC	0.598	0.461	1.563E-5	155	0.178	0.135	6yvaC.pdb.gz
13	AFDB:A0A087WTW0	0.561	0.083	2.354E-5	857	0.212	0.029	A0A087WTW0.pdb.gz	A0A087WTW0_HUMAN E3 ubiquitin-protein ligase UHRF OS=Homo sapiens OX=9606 GN=UHRF1 PE=1 SV=1
14	PDB:3ai5A	0.551	0.224	3.534E-5	299	0.153	0.060	3ai5A.pdb.gz
15	PDB:6mdhA	0.580	0.464	4.266E-5	149	0.161	0.128	6mdhA.pdb.gz
16	PDB:3plvA	0.584	0.844	4.836E-5	80	0.076	0.113	3plvA.pdb.gz	Role of the ubiquitin-like protein Hub1 in splice-site usage and alternative splicing.
17	PDB:7rbsB	0.599	0.457	5.149E-5	157	0.153	0.115	7rbsB.pdb.gz	Dual domain recognition determines SARS-CoV-2 PLpro selectivity for human ISG15 and K48-linked di-ubiquitin.
18	PDB:4pyuA	0.582	0.882	9.643E-5	76	0.076	0.118	4pyuA.pdb.gz	The conserved ubiquitin-like protein Hub1 plays a critical role in splicing in human cells.
19	PDB:3dbhI	0.575	0.769	1.696E-4	86	0.136	0.186	3dbhI.pdb.gz	Structural dissection of a gating mechanism preventing misactivation of ubiquitin by NEDD8's E1.
20	PDB:6ef3u	0.559	0.848	2.180E-4	75	0.161	0.253	6ef3u.pdb.gz	Substrate-engaged 26Sproteasome structures reveal mechanisms for ATP-hydrolysis-driven translocation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q15370	5.39e-84	242	118	1.000	1.000	ELOB_HUMAN Elongin-B OS=Homo sapiens OX=9606 GN=ELOB PE=1 SV=1
2	P62869	7.40e-81	234	118	0.975	0.975	ELOB_MOUSE Elongin-B OS=Mus musculus OX=10090 GN=Elob PE=1 SV=1
3	P62870	7.40e-81	234	118	0.975	0.975	ELOB_RAT Elongin-B OS=Rattus norvegicus OX=10116 GN=Elob PE=1 SV=1
4	O44226	6.09e-39	128	118	0.568	0.568	O44226_DROME Elongin B OS=Drosophila melanogaster OX=7227 GN=EloB PE=1 SV=1
5	G5ECR7	2.20e-19	79.0	118	0.356	0.356	G5ECR7_CAEEL RNA polymerase II transcription factor SIII p18 subunit OS=Caenorhabditis elegans OX=6239 GN=elb-1 PE=1 SV=1
6	Q8L8S0	1.40e-04	40.0	95	0.212	0.263	Q8L8S0_ARATH At5g57860 OS=Arabidopsis thaliana OX=3702 GN=MTI20.11 PE=1 SV=1
7	Q9FHQ6	0.068	34.3	322	0.195	0.071	UBQ9_ARATH Polyubiquitin 9 OS=Arabidopsis thaliana OX=3702 GN=UBQ9 PE=3 SV=1
8	A2Q831	0.70	30.8	128	0.229	0.211	A2Q831_ASPNC Contig An01c0080, genomic contig OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=An01g02880 PE=3 SV=1
9	Q921A3	1.1	30.4	161	0.110	0.081	UBD_RAT Ubiquitin D OS=Rattus norvegicus OX=10116 GN=Ubd PE=1 SV=1
10	Q3E7K8	1.2	30.4	230	0.161	0.083	UBQ12_ARATH Polyubiquitin 12 OS=Arabidopsis thaliana OX=3702 GN=UBQ12 PE=3 SV=1
11	Q8ID50	1.3	30.0	128	0.229	0.211	Q8ID50_PLAF7 Ubiquitin-60S ribosomal protein L40 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1365900 PE=1 SV=1
12	B9DHA6	2.1	29.3	128	0.195	0.180	RL40A_ARATH Ubiquitin-ribosomal protein eL40z fusion protein OS=Arabidopsis thaliana OX=3702 GN=RPL40A PE=2 SV=1
13	Q42202	2.1	29.3	128	0.195	0.180	RL40B_ARATH Ubiquitin-ribosomal protein eL40y fusion protein OS=Arabidopsis thaliana OX=3702 GN=RPL40B PE=2 SV=2
14	Q726X4	2.2	29.6	419	0.136	0.038	LEUC_DESVH 3-isopropylmalate dehydratase large subunit OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=leuC PE=1 SV=1
15	P0CH07	2.4	29.3	128	0.220	0.203	RL402_SCHPO Ubiquitin-ribosomal protein eL40B fusion protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=uep1 PE=1 SV=1
16	P0CH08	2.4	29.3	128	0.220	0.203	RL40A_YEAST Ubiquitin-ribosomal protein eL40A fusion protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPL40A PE=1 SV=1
17	P0CH09	2.4	29.3	128	0.220	0.203	RL40B_YEAST Ubiquitin-ribosomal protein eL40B fusion protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPL40B PE=1 SV=1
18	Q6FTH4	2.4	29.3	128	0.220	0.203	Q6FTH4_CANGA Candida glabrata strain CBS138 chromosome G complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0G02475g PE=3 SV=2
19	Q5ADS0	2.8	29.3	229	0.229	0.118	UBI4P_CANAL Polyubiquitin OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=UBI4 PE=3 SV=1
20	P05759	3.4	28.9	152	0.186	0.145	RS31_YEAST Ubiquitin-ribosomal protein eS31 fusion protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPS31 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11976 Rad60-SLD	35	15.6	Ubiquitin-2 like Rad60 SUMO-like
2	PF00240 ubiquitin	0.00028	31.9	Ubiquitin family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000007934

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000015275	0.999	Uncharacterized protein DKFZp469K2019
2	9601.ENSPPYP00000020952	0.999	Belongs to the SKP1 family.
3	9601.ENSPPYP00000022294	0.999	Cullin-2
4	9601.ENSPPYP00000013235	0.998	Ring-box 1, E3 ubiquitin protein ligase
5	9601.ENSPPYP00000004398	0.997	Core component of multiple SCF-like ECS (Elongin BC-Cullin 2/5-SOCS-box protein) E3 ubiquitin-protein ligase complexes, which mediate the ubiquitination and subsequent proteasomal degradation of target proteins. As a scaffold protein may contribute to catalysis through positioning of the substrate and the ubiquitin-conjugating enzyme. The functional specificity of the E3 ubiquitin-protein ligase complex depends on the variable substrate recognition component. ECS(SOCS1) seems to direct ubiquitination of JAK2. Seems to be involved in proteosomal degradation of p53/TP53 stimulated by ade [...]
6	9601.ENSPPYP00000006683	0.992	Hypoxia-inducible factor 1-alpha
7	9601.ENSPPYP00000009756	0.992	Suppressor of cytokine signaling 3
8	9601.ENSPPYP00000023677	0.990	Uncharacterized protein
9	9601.ENSPPYP00000005514	0.988	Suppressor of cytokine signaling 2
10	9601.ENSPPYP00000013892	0.987	Endothelial PAS domain protein 1
11	9601.ENSPPYP00000022530	0.983	Ankyrin repeat and SOCS box containing 9
12	9601.ENSPPYP00000006472	0.981	Neural precursor cell expressed, developmentally down-regulated 8
13	9601.ENSPPYP00000015846	0.975	Ring finger protein 7
14	9601.ENSPPYP00000008404	0.965	Core-binding factor, beta subunit
15	9601.ENSPPYP00000002009	0.958	Transcription elongation factor B (SIII), polypeptide 3 (110kDa, elongin A)
16	9601.ENSPPYP00000019496	0.938	Component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes (By similarity). The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF-type complexes such as SCF, CSA or DDB2 (By similarity). The complex is also involved in phosphorylation of p53/TP53, c-jun/JUN, IkappaBalpha/NFKBIA, ITPK1 and IRF8, possibly via its association with CK2 and PKD kinases (By similarity). [...]
17	9601.ENSPPYP00000015482	0.918	Cytokine inducible SH2-containing protein
18	9601.ENSPPYP00000006928	0.917	Ankyrin repeat and SOCS box containing 2
19	9601.ENSPPYP00000008028	0.906	Suppressor of cytokine signaling 1
20	9601.ENSPPYP00000006629	0.889	SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction. Substrate- recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Inhibits EGF signaling by mediating the degradation of the Tyr-phosphorylated EGF receptor/EGFR (By similarity)

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.321	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044238	0.991	primary metabolic process
GO:0044237	0.990	cellular metabolic process
GO:0006807	0.989	nitrogen compound metabolic process
GO:0043170	0.987	macromolecule metabolic process
GO:0050794	0.952	regulation of cellular process
GO:0034641	0.937	cellular nitrogen compound metabolic process
GO:0019222	0.900	regulation of metabolic process
GO:0010467	0.883	gene expression
GO:0009059	0.883	macromolecule biosynthetic process
GO:0044271	0.880	cellular nitrogen compound biosynthetic process
GO:0080090	0.865	regulation of primary metabolic process
GO:0010468	0.844	regulation of gene expression
GO:0031323	0.840	regulation of cellular metabolic process
GO:0006351	0.840	DNA-templated transcription
GO:0006355	0.825	regulation of DNA-templated transcription
GO:0048518	0.820	positive regulation of biological process
GO:0006366	0.816	transcription by RNA polymerase II
GO:0006357	0.801	regulation of transcription by RNA polymerase II
GO:0051173	0.793	positive regulation of nitrogen compound metabolic process
GO:0031325	0.781	positive regulation of cellular metabolic process
GO:0010604	0.776	positive regulation of macromolecule metabolic process
GO:0009891	0.704	positive regulation of biosynthetic process
GO:0045935	0.695	positive regulation of nucleobase-containing compound metabolic process
GO:0031328	0.690	positive regulation of cellular biosynthetic process
GO:0051254	0.686	positive regulation of RNA metabolic process
GO:0010557	0.676	positive regulation of macromolecule biosynthetic process
GO:0006354	0.676	DNA-templated transcription elongation
GO:0071840	0.657	cellular component organization or biogenesis
GO:0006352	0.638	DNA-templated transcription initiation
GO:0045893	0.637	positive regulation of DNA-templated transcription
GO:0016043	0.633	cellular component organization
GO:0045944	0.622	positive regulation of transcription by RNA polymerase II
GO:0006367	0.563	transcription initiation at RNA polymerase II promoter
GO:0043933	0.439	protein-containing complex organization
GO:0044085	0.401	cellular component biogenesis
GO:0006368	0.401	transcription elongation by RNA polymerase II
GO:1901564	0.361	organonitrogen compound metabolic process
GO:0022607	0.358	cellular component assembly
GO:0019538	0.320	protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005737	0.999	cytoplasm
GO:0031981	0.996	nuclear lumen
GO:0005654	0.993	nucleoplasm
GO:1902494	0.973	catalytic complex
GO:0005829	0.968	cytosol
GO:1990234	0.946	transferase complex
GO:0000151	0.762	ubiquitin ligase complex
GO:0140513	0.734	nuclear protein-containing complex
GO:0008023	0.696	transcription elongation factor complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]