StarFunc result for job id Q15375

User Input

>input (998 residues)
MVFQTRYPSWIILCYIWLLRFAHTGEAQAAKEVLLLDSKAQQTELEWISSPPNGWEEISG
LDENYTPIRTYQVCQVMEPNQNNWLRTNWISKGNAQRIFVELKFTLRDCNSLPGVLGTCK
ETFNLYYYETDYDTGRNIRENLYVKIDTIAADESFTQGDLGERKMKLNTEVREIGPLSKK
GFYLAFQDVGACIALVSVKVYYKKCWSIIENLAIFPDTVTGSEFSSLVEVRGTCVSSAEE
EAENAPRMHCSAEGEWLVPIGKCICKAGYQQKGDTCEPCGRGFYKSSSQDLQCSRCPTHS
FSDKEGSSRCECEDGYYRAPSDPPYVACTRPPSAPQNLIFNINQTTVSLEWSPPADNGGR
NDVTYRILCKRCSWEQGECVPCGSNIGYMPQQTGLEDNYVTVMDLLAHANYTFEVEAVNG
VSDLSRSQRLFAAVSITTGQAAPSQVSGVMKERVLQRSVELSWQEPEHPNGVITEYEIKY
YEKDQRERTYSTVKTKSTSASINNLKPGTVYVFQIRAFTAAGYGNYSPRLDVATLEEATG
KMFEATAVSSEQNPVIIIAVVAVAGTIILVFMVFGFIIGRRHCGYSKADQEGDEELYFHF
KFPGTKTYIDPETYEDPNRAVHQFAKELDASCIKIERVIGAGEFGEVCSGRLKLPGKRDV
AVAIKTLKVGYTEKQRRDFLCEASIMGQFDHPNVVHLEGVVTRGKPVMIVIEFMENGALD
AFLRKHDGQFTVIQLVGMLRGIAAGMRYLADMGYVHRDLAARNILVNSNLVCKVSDFGLS
RVIEDDPEAVYTTTGGKIPVRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDM
SNQDVIKAIEEGYRLPAPMDCPAGLHQLMLDCWQKERAERPKFEQIVGILDKMIRNPNSL
KTPLGTCSRPISPLLDQNTPDFTTFCSVGEWLQAIKMERYKDNFTAAGYNSLESVARMTI
EDVMSLGITLVGHQKKIMSSIQTMRAQMLHLHGTGIQV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0B4J1T8	0.440	0.392	0.000	1130	0.590	0.521	A0A0B4J1T8.pdb.gz	A0A0B4J1T8_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHA6 PE=1 SV=1
2	AFDB:A0A0G2JY48	0.555	0.560	0.000	986	0.567	0.574	A0A0G2JY48.pdb.gz	A0A0G2JY48_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Ephb2 PE=1 SV=2
3	AFDB:A0A3B3IRY8	0.442	0.421	0.000	1055	0.545	0.516	A0A3B3IRY8.pdb.gz	A0A3B3IRY8_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHB1 PE=1 SV=1
4	AFDB:D3ZDH4	0.372	0.379	0.000	977	0.439	0.448	D3ZDH4.pdb.gz	D3ZDH4_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Epha1 PE=1 SV=1
5	AFDB:F1Q9D9	0.543	0.560	0.000	963	0.586	0.607	F1Q9D9.pdb.gz
6	AFDB:F1RCL1	0.416	0.425	0.000	976	0.604	0.618	F1RCL1.pdb.gz
7	AFDB:O08680	0.494	0.499	0.000	984	0.611	0.620	O08680.pdb.gz	EPHA3_RAT Ephrin type-A receptor 3 OS=Rattus norvegicus OX=10116 GN=Epha3 PE=2 SV=1
8	AFDB:O15197	0.394	0.386	0.000	1021	0.424	0.414	O15197.pdb.gz	EPHB6_HUMAN Ephrin type-B receptor 6 OS=Homo sapiens OX=9606 GN=EPHB6 PE=1 SV=4
9	AFDB:O73875	0.408	0.412	0.000	987	0.473	0.478	O73875.pdb.gz	EPB4A_DANRE Ephrin type-B receptor 4a OS=Danio rerio OX=7955 GN=ephb4a PE=1 SV=3
10	AFDB:O73878	0.397	0.406	0.000	976	0.485	0.496	O73878.pdb.gz	EPB4B_DANRE Ephrin type-B receptor 4b OS=Danio rerio OX=7955 GN=ephb4b PE=1 SV=2
11	PDB:2h8hA	0.243	0.517	9.707E-23	445	0.148	0.333	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
12	PDB:4fl2A	0.249	0.437	3.838E-21	555	0.102	0.184	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
13	PDB:1k9aB	0.244	0.535	6.519E-20	441	0.103	0.234	1k9aB.pdb.gz
14	PDB:4k2rA	0.246	0.434	8.357E-20	551	0.103	0.187	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
15	PDB:6s73A	0.234	0.798	9.376E-15	269	0.066	0.245	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
16	PDB:6lk5A	0.233	0.812	3.090E-14	265	0.058	0.219	6lk5A.pdb.gz
17	PDB:8dksA	0.207	0.664	3.247E-14	283	0.067	0.237	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
18	PDB:6uanB	0.211	0.748	1.943E-13	261	0.084	0.322	6uanB.pdb.gz
19	PDB:6pxvA	0.162	0.192	3.039E-13	823	0.072	0.087	6pxvA.pdb.gz
20	PDB:7mfdA	0.233	0.520	3.193E-13	410	0.085	0.207	7mfdA.pdb.gz	Structural insights into the BRAF monomer-to-dimer transition mediated by RAS binding.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0B4J1T8	1241	1130	0.594	0.525	A0A0B4J1T8_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHA6 PE=1 SV=1
2	A0A0G2JY48	1109	965	0.547	0.566	A0A0G2JY48_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Ephb2 PE=1 SV=2
3	A0A140VJJ0	1296	983	0.610	0.620	A0A140VJJ0_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHA3 PE=2 SV=1
4	A0A3B3IRY8	1119	1055	0.546	0.517	A0A3B3IRY8_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHB1 PE=1 SV=1
5	B1AKC9	1139	946	0.552	0.582	B1AKC9_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHB2 PE=1 SV=1
6	B2B9B0	1175	986	0.570	0.577	B2B9B0_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Ephb2 PE=2 SV=1
7	C9JXA2	1248	918	0.588	0.639	C9JXA2_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHA3 PE=1 SV=1
8	D1YSF9	724	1005	0.416	0.413	D1YSF9_DROME receptor protein-tyrosine kinase OS=Drosophila melanogaster OX=7227 GN=Eph PE=4 SV=1
9	D3ZDH4	808	977	0.434	0.443	D3ZDH4_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Epha1 PE=1 SV=1
10	D3ZZK3	1268	949	0.606	0.638	D3ZZK3_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Epha4 PE=4 SV=2
11	F1MAJ0	1169	987	0.569	0.575	F1MAJ0_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Ephb2 PE=1 SV=4
12	O08644	796	1014	0.423	0.416	EPHB6_MOUSE Ephrin type-B receptor 6 OS=Mus musculus OX=10090 GN=Ephb6 PE=2 SV=4
13	O08680	1280	984	0.612	0.621	EPHA3_RAT Ephrin type-A receptor 3 OS=Rattus norvegicus OX=10116 GN=Epha3 PE=2 SV=1
14	O09127	1195	1004	0.568	0.565	EPHA8_MOUSE Ephrin type-A receptor 8 OS=Mus musculus OX=10090 GN=Epha8 PE=1 SV=2
15	O15197	781	1021	0.413	0.404	EPHB6_HUMAN Ephrin type-B receptor 6 OS=Homo sapiens OX=9606 GN=EPHB6 PE=1 SV=4
16	O73875	912	987	0.483	0.488	EPB4A_DANRE Ephrin type-B receptor 4a OS=Danio rerio OX=7955 GN=ephb4a PE=1 SV=3
17	O73878	949	976	0.506	0.517	EPB4B_DANRE Ephrin type-B receptor 4b OS=Danio rerio OX=7955 GN=ephb4b PE=1 SV=2
18	O96435	723	1019	0.421	0.412	O96435_DROME receptor protein-tyrosine kinase OS=Drosophila melanogaster OX=7227 GN=Eph PE=2 SV=1
19	P09759	1165	984	0.566	0.574	EPHB1_RAT Ephrin type-B receptor 1 OS=Rattus norvegicus OX=10116 GN=Ephb1 PE=1 SV=2
20	P21709	815	976	0.443	0.453	EPHA1_HUMAN Ephrin type-A receptor 1 OS=Homo sapiens OX=9606 GN=EPHA1 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	87	13.7	ABC1 atypical kinase-like domain
2	PF16389 DUF4998	39	15.3	Domain of unknown function
3	PF12947 EGF_3	3.9e+02	12.7	EGF domain
4	PF14575 EphA2_TM	4.7e-20	83.4	Ephrin type-A receptor 2 transmembrane domain
5	PF01404 Ephrin_lbd	7.8e-67	236.3	Ephrin receptor ligand binding domain
6	PF07699 Ephrin_rec_like	0.016	26.3	Tyrosine-protein kinase ephrin type A/B receptor-like
7	PF00041 fn3	3.1e-27	106.0	Fibronectin type III domain
8	PF16893 fn3_2	18	16.9	Fibronectin type III domain
9	PF10080 FtrD-like	3.3e+02	12.8	Membrane iron-sulfur containing protein FtrD-like
10	PF12330 Haspin_kinase	1.6e+02	12.6	Haspin like kinase domain
11	PF09294 Interfer-bind	28	16.4	Interferon-alpha/beta receptor, fibronectin type III
12	PF06293 Kdo	3.5e+02	12.0	Lipopolysaccharide kinase (Kdo/WaaP) family
13	PF00069 Pkinase	4.1e-42	156.0	Protein kinase domain
14	PF17667 Pkinase_fungal	3.6e+02	11.3	Fungal protein kinase
15	PF07714 PK_Tyr_Ser-Thr	3.5e-94	326.5	Protein tyrosine and serine/threonine kinase
16	PF16656 Pur_ac_phosph_N	1.2	21.1	Purple acid Phosphatase, N-terminal domain
17	PF00536 SAM_1	1.2e-18	78.6	SAM domain (Sterile alpha motif)
18	PF07647 SAM_2	1.4e-17	74.9	SAM domain (Sterile alpha motif)
19	PF01108 Tissue_fac	15	16.9	Tissue factor
20	PF07495 Y_Y_Y	1.5e+02	13.7	Y_Y_Y domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000358309

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000328777	0.999	Ephrin-A5
2	9606.ENSP00000215368	0.989	Ephrin-A2
3	9606.ENSP00000337451	0.967	Ephrin type-A receptor 3
4	9606.ENSP00000414378	0.954	Ephrin-A4
5	9606.ENSP00000245323	0.937	Ephrin-B2
6	9606.ENSP00000400175	0.931	Transforming protein RhoA
7	9606.ENSP00000357393	0.924	Ephrin-A3
8	9606.ENSP00000281821	0.917	Ephrin type-A receptor 4
9	9606.ENSP00000374323	0.915	Ephrin type-A receptor 6
10	9606.ENSP00000346671	0.911	Tyrosine-protein kinase Fyn
11	9606.ENSP00000362680	0.911	Proto-oncogene tyrosine-protein kinase Src
12	9606.ENSP00000357392	0.909	Ephrin-A1
13	9606.ENSP00000480763	0.909	Ephrin type-A receptor 5
14	9606.ENSP00000462468	0.908	Tyrosine-protein kinase Yes
15	9606.ENSP00000419782	0.906	Cyclin-dependent-like kinase 5
16	9606.ENSP00000337825	0.904	Tyrosine-protein kinase Lck
17	9606.ENSP00000363117	0.903	Tyrosine-protein kinase Fgr
18	9606.ENSP00000428924	0.903	Tyrosine-protein kinase Lyn
19	9606.ENSP00000259089	0.902	Tyrosine-protein kinase Blk
20	9606.ENSP00000444986	0.902	Tyrosine-protein kinase HCK

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004713	1.000	protein tyrosine kinase activity
GO:0004888	0.963	transmembrane signaling receptor activity
GO:0004714	0.877	transmembrane receptor protein tyrosine kinase activity
GO:0005102	0.545	signaling receptor binding
GO:0005003	0.539	ephrin receptor activity
GO:0046875	0.488	ephrin receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.992	regulation of cellular process
GO:0050896	0.987	response to stimulus
GO:0009987	0.987	cellular process
GO:0032501	0.981	multicellular organismal process
GO:0048856	0.980	anatomical structure development
GO:0023052	0.977	signaling
GO:0051716	0.977	cellular response to stimulus
GO:0007165	0.973	signal transduction
GO:0048519	0.972	negative regulation of biological process
GO:0048518	0.964	positive regulation of biological process
GO:0048013	0.944	ephrin receptor signaling pathway
GO:0007275	0.943	multicellular organism development
GO:0048731	0.932	system development
GO:0019222	0.906	regulation of metabolic process
GO:0070372	0.901	regulation of ERK1 and ERK2 cascade
GO:0007399	0.884	nervous system development
GO:0048522	0.862	positive regulation of cellular process
GO:0080090	0.842	regulation of primary metabolic process
GO:0060255	0.837	regulation of macromolecule metabolic process
GO:0051171	0.836	regulation of nitrogen compound metabolic process
GO:0022603	0.832	regulation of anatomical structure morphogenesis
GO:0008152	0.819	metabolic process
GO:0001932	0.817	regulation of protein phosphorylation
GO:0071704	0.812	organic substance metabolic process
GO:0044237	0.811	cellular metabolic process
GO:0042221	0.804	response to chemical
GO:0044238	0.793	primary metabolic process
GO:0048523	0.781	negative regulation of cellular process
GO:0065009	0.756	regulation of molecular function
GO:0051128	0.754	regulation of cellular component organization
GO:0016310	0.752	phosphorylation
GO:0016043	0.745	cellular component organization
GO:0006807	0.737	nitrogen compound metabolic process
GO:0050790	0.724	regulation of catalytic activity
GO:0045595	0.722	regulation of cell differentiation
GO:0043170	0.716	macromolecule metabolic process
GO:0019538	0.706	protein metabolic process
GO:0051239	0.690	regulation of multicellular organismal process
GO:0065008	0.668	regulation of biological quality
GO:0043067	0.653	regulation of programmed cell death
GO:0043412	0.642	macromolecule modification
GO:0009893	0.624	positive regulation of metabolic process
GO:2000026	0.584	regulation of multicellular organismal development
GO:0036211	0.506	protein modification process
GO:0051241	0.499	negative regulation of multicellular organismal process
GO:0030154	0.439	cell differentiation
GO:0031344	0.419	regulation of cell projection organization
GO:0051173	0.404	positive regulation of nitrogen compound metabolic process
GO:0030155	0.400	regulation of cell adhesion
GO:0050730	0.391	regulation of peptidyl-tyrosine phosphorylation
GO:0120035	0.385	regulation of plasma membrane bounded cell projection organization
GO:0044093	0.372	positive regulation of molecular function
GO:0006468	0.364	protein phosphorylation
GO:0010604	0.347	positive regulation of macromolecule metabolic process
GO:0080134	0.334	regulation of response to stress
GO:0010975	0.307	regulation of neuron projection development
GO:0048585	0.303	negative regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005622	0.722	intracellular anatomical structure
GO:0043226	0.704	organelle
GO:0030054	0.670	cell junction
GO:0005737	0.580	cytoplasm
GO:0005829	0.489	cytosol
GO:0043227	0.414	membrane-bounded organelle
GO:0012505	0.337	endomembrane system
GO:0045202	0.328	synapse
GO:0043229	0.315	intracellular organelle
GO:0043231	0.304	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10596	1.000	ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein]
EC:2.7.10.1	0.877	receptor protein-tyrosine kinase.

[back to server]