StarFunc result for job id Q15382

User Input

>input (184 residues)
MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVD
TAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNK
KDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFRRIILEAEKMDGAASQGKSS
CSVM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15382	1.000	1.000	1.369E-38	184	1.000	1.000	Q15382.pdb.gz	RHEB_HUMAN GTP-binding protein Rheb OS=Homo sapiens OX=9606 GN=RHEB PE=1 SV=1
2	PDB:3t5gA	0.875	0.940	4.053E-30	171	0.891	0.959	3t5gA.pdb.gz	Arl2-GTP and Arl3-GTP regulate a GDI-like transport system for farnesylated cargo.
3	AFDB:Q9VND8	0.905	0.914	4.741E-27	182	0.609	0.615	Q9VND8.pdb.gz	RHEB_DROME GTP-binding protein Rheb homolog OS=Drosophila melanogaster OX=7227 GN=Rheb PE=1 SV=1
4	AFDB:Q8TAI7	0.950	0.955	9.523E-27	183	0.511	0.514	Q8TAI7.pdb.gz	REBL1_HUMAN GTPase RhebL1 OS=Homo sapiens OX=9606 GN=RHEBL1 PE=1 SV=1
5	AFDB:Q550Q4	0.895	0.890	1.999E-25	185	0.500	0.497	Q550Q4.pdb.gz	RHEB_DICDI GTP-binding protein Rheb homolog OS=Dictyostelium discoideum OX=44689 GN=rheb PE=3 SV=1
6	AFDB:Q5ANA9	0.917	0.917	3.537E-25	184	0.451	0.451	Q5ANA9.pdb.gz	Q5ANA9_CANAL GTPase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RHB1 PE=4 SV=1
7	AFDB:O94363	0.914	0.909	4.278E-25	185	0.511	0.508	O94363.pdb.gz	RHB1_SCHPO GTP-binding protein rhb1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rhb1 PE=3 SV=1
8	PDB:7btaB	0.770	0.975	9.326E-24	145	0.772	0.979	7btaB.pdb.gz	Molecular basis for the functions of dominantly active Y35N and inactive D60K Rheb mutants in mTORC1 signaling.
9	PDB:3oesA	0.823	0.962	1.724E-22	157	0.478	0.561	3oesA.pdb.gz	Crystal structure of the small GTPase RhebL1
10	AFDB:E9R5S0	0.893	0.879	3.129E-22	187	0.500	0.492	E9R5S0.pdb.gz	E9R5S0_ASPFU Rheb small monomeric GTPase RhbA OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_5G05480 PE=4 SV=1
11	AFDB:O17599	0.923	0.938	5.430E-21	181	0.408	0.414	O17599.pdb.gz	O17599_CAEEL small monomeric GTPase OS=Caenorhabditis elegans OX=6239 GN=rap-2 PE=1 SV=2
12	AFDB:P03967	0.902	0.888	7.944E-21	187	0.375	0.369	P03967.pdb.gz	RASD_DICDI Ras-like protein rasD OS=Dictyostelium discoideum OX=44689 GN=rasD PE=1 SV=2
13	AFDB:P0CY32	0.917	0.589	9.018E-21	290	0.364	0.231	P0CY32.pdb.gz	RAS1_CANAX Ras-like protein 1 OS=Candida albicans OX=5476 GN=RAS1 PE=3 SV=1
14	PDB:6kykC	0.841	0.912	8.092E-20	169	0.353	0.385	6kykC.pdb.gz	Shank3 Binds to and Stabilizes the Active Form of Rap1 and HRas GTPases via Its NTD-ANK Tandem with Distinct Mechanisms.
15	PDB:6zizA	0.867	0.936	4.484E-19	170	0.310	0.335	6zizA.pdb.gz	Drugging all RAS isoforms with one pocket.
16	PDB:1kaoA	0.850	0.933	2.647E-18	167	0.348	0.383	1kaoA.pdb.gz	Crystal structures of the small G protein Rap2A in complex with its substrate GTP, with GDP and with GTPgammaS.
17	PDB:6if2B	0.823	0.849	1.138E-17	178	0.310	0.320	6if2B.pdb.gz	Rab35/ACAP2 and Rab35/RUSC2 Complex Structures Reveal Molecular Basis for Effector Recognition by Rab35 GTPase.
18	PDB:7sd0B	0.845	0.891	3.140E-17	174	0.326	0.345	7sd0B.pdb.gz	Structural basis for SHOC2 modulation of RAS signalling.
19	PDB:2f9mA	0.879	0.888	5.214E-17	182	0.288	0.291	2f9mA.pdb.gz	The crystal structure of the small GTPase Rab11b reveals critical differences relative to the Rab11a isoform.
20	PDB:6zqtA	0.857	0.909	1.438E-16	173	0.288	0.306	6zqtA.pdb.gz	Affinity maturation of the RLIP76 Ral binding domain to inform the design of stapled peptides targeting the Ral GTPases.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q15382	7.95e-136	379	184	1.000	1.000	RHEB_HUMAN GTP-binding protein Rheb OS=Homo sapiens OX=9606 GN=RHEB PE=1 SV=1
2	Q62639	5.37e-135	376	184	0.995	0.995	RHEB_RAT GTP-binding protein Rheb OS=Rattus norvegicus OX=10116 GN=Rheb PE=1 SV=1
3	Q921J2	1.96e-134	375	184	0.989	0.989	RHEB_MOUSE GTP-binding protein Rheb OS=Mus musculus OX=10090 GN=Rheb PE=1 SV=1
4	Q9VND8	2.85e-81	240	182	0.636	0.643	RHEB_DROME GTP-binding protein Rheb homolog OS=Drosophila melanogaster OX=7227 GN=Rheb PE=1 SV=1
5	Q8TAI7	5.32e-68	207	183	0.522	0.525	REBL1_HUMAN GTPase RhebL1 OS=Homo sapiens OX=9606 GN=RHEBL1 PE=1 SV=1
6	O94363	9.05e-66	201	185	0.522	0.519	RHB1_SCHPO GTP-binding protein rhb1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rhb1 PE=3 SV=1
7	Q550Q4	1.14e-61	191	185	0.522	0.519	RHEB_DICDI GTP-binding protein Rheb homolog OS=Dictyostelium discoideum OX=44689 GN=rheb PE=3 SV=1
8	E9R5S0	8.94e-56	176	187	0.500	0.492	E9R5S0_ASPFU Rheb small monomeric GTPase RhbA OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_5G05480 PE=4 SV=1
9	Q5ANA9	4.37e-55	174	184	0.462	0.462	Q5ANA9_CANAL GTPase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RHB1 PE=4 SV=1
10	O17599	4.14e-42	141	181	0.380	0.387	O17599_CAEEL small monomeric GTPase OS=Caenorhabditis elegans OX=6239 GN=rap-2 PE=1 SV=2
11	B5XGC1	2.13e-40	137	184	0.375	0.375	B5XGC1_SALSA small monomeric GTPase OS=Salmo salar OX=8030 GN=RAP1B PE=2 SV=1
12	B5X2X6	2.29e-40	137	185	0.359	0.357	B5X2X6_SALSA small monomeric GTPase OS=Salmo salar OX=8030 GN=RAP1B PE=2 SV=1
13	B9EMH1	2.55e-40	137	185	0.359	0.357	B9EMH1_SALSA small monomeric GTPase OS=Salmo salar OX=8030 GN=RAP1B PE=2 SV=1
14	Q6IQP4	2.91e-40	136	185	0.370	0.368	Q6IQP4_DANRE small monomeric GTPase OS=Danio rerio OX=7955 GN=rap1a PE=1 SV=1
15	Q18246	5.06e-40	136	188	0.375	0.367	RAP1_CAEEL Ras-related protein Rap-1 OS=Caenorhabditis elegans OX=6239 GN=rap-1 PE=3 SV=1
16	Q6TEN1	9.95e-40	135	184	0.370	0.370	RAP1B_DANRE Ras-related protein Rap-1b OS=Danio rerio OX=7955 GN=rap1b PE=2 SV=1
17	P25378	1.16e-39	135	209	0.391	0.344	RHEB_YEAST Rheb-like protein RHB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RHB1 PE=1 SV=2
18	P61223	1.26e-39	135	184	0.380	0.380	RAP1B_BOVIN Ras-related protein Rap-1b OS=Bos taurus OX=9913 GN=RAP1B PE=2 SV=1
19	P61224	1.26e-39	135	184	0.380	0.380	RAP1B_HUMAN Ras-related protein Rap-1b OS=Homo sapiens OX=9606 GN=RAP1B PE=1 SV=1
20	Q62636	1.26e-39	135	184	0.380	0.380	RAP1B_RAT Ras-related protein Rap-1b OS=Rattus norvegicus OX=10116 GN=Rap1b PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13173 AAA_14	3.6e+02	12.6	AAA domain
2	PF00025 Arf	0.00017	32.6	ADP-ribosylation factor family
3	PF00009 GTP_EFTU	0.19	22.8	Elongation factor Tu GTP binding domain
4	PF01926 MMR_HSR1	0.12	23.8	50S ribosome-binding GTPase
5	PF00071 Ras	2.5e-43	159.0	Ras family
6	PF08477 Roc	1.6e-13	62.3	Ras of Complex, Roc, domain of DAPkinase
7	PF03193 RsgA_GTPase	0.65	21.4	RsgA GTPase
8	PF09439 SRPRB	5	18.0	Signal recognition particle receptor beta subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000005480

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000011677	0.999	Serine/threonine-protein kinase mTOR
2	61853.ENSNLEP00000011129	0.998	Tuberous sclerosis 2
3	61853.ENSNLEP00000019227	0.998	Regulatory associated protein of MTOR, complex 1
4	61853.ENSNLEP00000015722	0.996	Tuberous sclerosis 1
5	61853.ENSNLEP00000011254	0.990	MTOR associated protein, LST8 homolog (S. cerevisiae)
6	61853.ENSNLEP00000001938	0.982	BCL2/adenovirus E1B 19kDa interacting protein 3
7	61853.ENSNLEP00000006084	0.965	DEP domain containing MTOR-interacting protein
8	61853.ENSNLEP00000006561	0.964	AKT1 substrate 1 (proline-rich)
9	61853.ENSNLEP00000017234	0.944	Phosphodiesterase 6D, cGMP-specific, rod, delta
10	61853.ENSNLEP00000000960	0.922	TBC1 domain family, member 7
11	61853.ENSNLEP00000000805	0.916	Ribosomal protein S6 kinase, 70kDa, polypeptide 1
12	61853.ENSNLEP00000019838	0.882	V-akt murine thymoma viral oncogene homolog 1
13	61853.ENSNLEP00000007776	0.863	Ribosomal protein S6 kinase, 70kDa, polypeptide 2
14	61853.ENSNLEP00000014355	0.850	annotation not available
15	61853.ENSNLEP00000022844	0.848	Ras-related GTP binding A
16	61853.ENSNLEP00000022892	0.843	Belongs to the eukaryotic initiation factor 4E family.
17	61853.ENSNLEP00000015758	0.840	WD repeat domain 59
18	61853.ENSNLEP00000009719	0.824	NPR3 like, GATOR1 complex subunit
19	61853.ENSNLEP00000008544	0.823	NPR2 like, GATOR1 complex subunit
20	61853.ENSNLEP00000019574	0.818	Missing oocyte, meiosis regulator, homolog (Drosophila)

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005525	1.000	GTP binding
GO:0003924	0.999	GTPase activity
GO:0019003	0.994	GDP binding
GO:0019899	0.338	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050794	0.996	regulation of cellular process
GO:0048518	0.985	positive regulation of biological process
GO:0050896	0.979	response to stimulus
GO:0019222	0.976	regulation of metabolic process
GO:0048583	0.975	regulation of response to stimulus
GO:0048522	0.975	positive regulation of cellular process
GO:0007154	0.973	cell communication
GO:0050793	0.971	regulation of developmental process
GO:0009966	0.966	regulation of signal transduction
GO:0032006	0.960	regulation of TOR signaling
GO:0051716	0.817	cellular response to stimulus
GO:0051239	0.817	regulation of multicellular organismal process
GO:0051128	0.810	regulation of cellular component organization
GO:0023056	0.804	positive regulation of signaling
GO:0048519	0.797	negative regulation of biological process
GO:0032008	0.791	positive regulation of TOR signaling
GO:0007264	0.786	small GTPase mediated signal transduction
GO:0045595	0.782	regulation of cell differentiation
GO:0031323	0.782	regulation of cellular metabolic process
GO:0065008	0.773	regulation of biological quality
GO:0032502	0.708	developmental process
GO:2000026	0.658	regulation of multicellular organismal development
GO:0051960	0.623	regulation of nervous system development
GO:0048523	0.606	negative regulation of cellular process
GO:0060255	0.584	regulation of macromolecule metabolic process
GO:0051094	0.560	positive regulation of developmental process
GO:0032501	0.555	multicellular organismal process
GO:0045597	0.551	positive regulation of cell differentiation
GO:0060284	0.512	regulation of cell development
GO:0045685	0.512	regulation of glial cell differentiation
GO:0050803	0.499	regulation of synapse structure or activity
GO:0048713	0.473	regulation of oligodendrocyte differentiation
GO:0051962	0.468	positive regulation of nervous system development
GO:0050807	0.456	regulation of synapse organization
GO:0009894	0.413	regulation of catabolic process
GO:0080090	0.399	regulation of primary metabolic process
GO:0051171	0.395	regulation of nitrogen compound metabolic process
GO:0048856	0.379	anatomical structure development
GO:0031329	0.376	regulation of cellular catabolic process
GO:0010506	0.372	regulation of autophagy
GO:0006950	0.366	response to stress
GO:0007275	0.351	multicellular organism development
GO:0009893	0.351	positive regulation of metabolic process
GO:0010468	0.338	regulation of gene expression
GO:0099175	0.333	regulation of postsynapse organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.996	membrane-bounded organelle
GO:0005737	0.996	cytoplasm
GO:0043229	0.996	intracellular organelle
GO:0032991	0.992	protein-containing complex
GO:0043231	0.992	intracellular membrane-bounded organelle
GO:0005634	0.962	nucleus
GO:0016020	0.954	membrane
GO:0031090	0.938	organelle membrane
GO:0005829	0.931	cytosol
GO:0005773	0.923	vacuole
GO:0030054	0.890	cell junction
GO:0098588	0.880	bounding membrane of organelle
GO:0005764	0.874	lysosome
GO:0005576	0.812	extracellular region
GO:0031982	0.793	vesicle
GO:0045202	0.778	synapse
GO:0005774	0.775	vacuolar membrane
GO:0012505	0.770	endomembrane system
GO:0005615	0.683	extracellular space
GO:0005765	0.672	lysosomal membrane
GO:0005886	0.644	plasma membrane
GO:0070013	0.515	intracellular organelle lumen
GO:0031981	0.505	nuclear lumen
GO:0005654	0.444	nucleoplasm
GO:0042995	0.390	cell projection
GO:0070062	0.383	extracellular exosome
GO:0120025	0.371	plasma membrane bounded cell projection
GO:0031410	0.361	cytoplasmic vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19669	0.999	GTP + H2O = GDP + H(+) + phosphate

[back to server]