StarFunc result for job id Q15386

User Input

>input (1083 residues)
MFSFEGDFKTRPKVSLGGASRKEEKASLLHRTQEERRKREEERRRLKNAIIIQSFIRGYR
DRKQQYSIQRSAFDRCATLSQSGGAFPIANGPNLTLLVRQLLFFYKQNEDSKRLIWLYQN
LIKHSSLFVKQLDGSERLTCLFQIKRLMSLCCRLLQNCNDDSLNVALPMRMLEVFSSENT
YLPVLQDASYVVSVIEQILHYMIHNGYYRSLYLLINSKLPSSIEYSDLSRVPIAKILLEN
VLKPLHFTYNSCPEGARQQVFTAFTEEFLAAPFTDQIFHFIIPALADAQTVFPYEPFLNA
LLLIESRCSRKSGGAPWLFYFVLTVGENYLGALSEEGLLVYLRVLQTFLSQLPVSPASAS
CHDSASDSEEESEEADKPSSPEDGRLSVSYITEECLKKLDTKQQTNTLLNLVWRDSASEE
VFTTMASVCHTLMVQHRMMVPKVRLLYSLAFNARFLRHLWFLISSMSTRMITGSMVPLLQ
VISRGSPMSFEDSSRIIPLFYLFSSLFSHSLISIHDNEFFGDPIEVVGQRQSSMMPFTLE
ELIMLSRCLRDACLGIIKLAYPETKPEVREEYITAFQSIGVTTSSEMQQCIQMEQKRWIQ
LFKVITNLVKMLKSRDTRRNFCPPNHWLSEQEDIKADKVTQLYVPASRHVWRFRRMGRIG
PLQSTLDVGLESPPLSVSEERQLAVLTELPFVVPFEERVKIFQRLIYADKQEVQGDGPFL
DGINVTIRRNYIYEDAYDKLSPENEPDLKKRIRVHLLNAHGLDEAGIDGGGIFREFLNEL
LKSGFNPNQGFFKTTNEGLLYPNPAAQMLVGDSFARHYYFLGRMLGKALYENMLVELPFA
GFFLSKLLGTSADVDIHHLASLDPEVYKNLLFLKSYEDDVEELGLNFTVVNNDLGEAQVV
ELKFGGKDIPVTSANRIAYIHLVADYRLNRQIRQHCLAFRQGLANVVSLEWLRMFDQQEI
QVLISGAQVPISLEDLKSFTNYSGGYSADHPVIKVFWRVVEGFTDEEKRKLLKFVTSCSR
PPLLGFKELYPAFCIHNGGSDLERLPTASTCMNLLKLPEFYDETLLRSKLLYAIECAAGF
ELS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15386	1.000	1.000	0.000	1083	1.000	1.000	Q15386.pdb.gz	UBE3C_HUMAN Ubiquitin-protein ligase E3C OS=Homo sapiens OX=9606 GN=UBE3C PE=1 SV=3
2	AFDB:Q9W196	0.867	0.838	2.578E-65	1122	0.396	0.382	Q9W196.pdb.gz	Q9W196_DROME HECT-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=Dmel\CG3356 PE=1 SV=1
3	AFDB:Q1K9C4	0.610	0.639	2.551E-40	1029	0.257	0.270	Q1K9C4.pdb.gz	YFK7_SCHPO Probable E3 ubiquitin protein ligase C167.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC167.07c PE=2 SV=1
4	AFDB:O17736	0.698	0.749	8.561E-40	1001	0.243	0.263	O17736.pdb.gz	ETC1_CAEEL E3 ubiquitin-protein ligase etc-1 OS=Caenorhabditis elegans OX=6239 GN=etc-1 PE=1 SV=1
5	AFDB:P53119	0.483	0.561	2.070E-31	910	0.243	0.289	P53119.pdb.gz	HUL5_YEAST E3 ubiquitin-protein ligase HUL5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HUL5 PE=1 SV=1
6	AFDB:F8W2M1	0.235	0.278	1.936E-22	904	0.187	0.225	F8W2M1.pdb.gz	HACE1_DANRE E3 ubiquitin-protein ligase HACE1 OS=Danio rerio OX=7955 GN=hace1 PE=3 SV=2
7	AFDB:Q8IYU2	0.253	0.296	2.314E-22	909	0.195	0.232	Q8IYU2.pdb.gz	HACE1_HUMAN E3 ubiquitin-protein ligase HACE1 OS=Homo sapiens OX=9606 GN=HACE1 PE=1 SV=2
8	AFDB:Q05086	0.369	0.449	5.637E-22	875	0.184	0.227	Q05086.pdb.gz	UBE3A_HUMAN Ubiquitin-protein ligase E3A OS=Homo sapiens OX=9606 GN=UBE3A PE=1 SV=4
9	AFDB:Q5GLZ8	0.369	0.377	7.323E-21	1057	0.141	0.145	Q5GLZ8.pdb.gz	HERC4_HUMAN Probable E3 ubiquitin-protein ligase HERC4 OS=Homo sapiens OX=9606 GN=HERC4 PE=1 SV=1
10	AFDB:P46935	0.234	0.283	1.249E-20	887	0.117	0.143	P46935.pdb.gz	NEDD4_MOUSE E3 ubiquitin-protein ligase NEDD4 OS=Mus musculus OX=10090 GN=Nedd4 PE=1 SV=3
11	PDB:7jq9A	0.232	0.110	8.163E-20	2427	0.195	0.087	7jq9A.pdb.gz
12	PDB:7mopA	0.221	0.105	1.943E-18	2445	0.182	0.081	7mopA.pdb.gz	Solenoid architecture of HUWE1 contributes to ligase activity and substrate recognition.
13	PDB:6gx9A	0.121	0.138	3.184E-4	912	0.105	0.125	6gx9A.pdb.gz	Differential role for phosphorylation in alternative polyadenylation function versus nuclear import of SR-like protein CPSF6.
14	PDB:4a0cA	0.131	0.126	3.419E-4	1155	0.117	0.110	4a0cA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
15	PDB:7u9tA	0.124	0.045	5.433E-4	4229	0.106	0.027	7u9tA.pdb.gz	Structural analyses of human ryanodine receptor type 2 channels reveal the mechanisms for sudden cardiac death and treatment.
16	PDB:5yu7A	0.184	0.180	6.727E-4	1118	0.109	0.106	5yu7A.pdb.gz
17	PDB:5lqwQ	0.128	0.158	1.277E-3	791	0.088	0.120	5lqwQ.pdb.gz	Molecular architecture of the Saccharomyces cerevisiae activated spliceosome
18	PDB:7sicA	0.160	0.080	1.473E-3	2773	0.114	0.044	7sicA.pdb.gz	Structure of the human ATM kinase and mechanism of Nbs1 binding.
19	PDB:4r0zA	0.138	0.210	1.581E-3	557	0.070	0.136	4r0zA.pdb.gz
20	PDB:7kzvV	0.120	0.116	1.958E-3	1155	0.118	0.111	7kzvV.pdb.gz	Structure of the FA core ubiquitin ligase closing the ID clamp on DNA.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q15386	0.0	2234	1083	1.000	1.000	UBE3C_HUMAN Ubiquitin-protein ligase E3C OS=Homo sapiens OX=9606 GN=UBE3C PE=1 SV=3
2	Q9W196	0.0	717	1122	0.404	0.389	Q9W196_DROME HECT-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=Dmel\CG3356 PE=1 SV=1
3	Q1K9C4	4.29e-98	336	1029	0.165	0.174	YFK7_SCHPO Probable E3 ubiquitin protein ligase C167.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC167.07c PE=2 SV=1
4	O17736	5.62e-96	330	1001	0.154	0.167	ETC1_CAEEL E3 ubiquitin-protein ligase etc-1 OS=Caenorhabditis elegans OX=6239 GN=etc-1 PE=1 SV=1
5	P53119	1.65e-77	276	910	0.163	0.195	HUL5_YEAST E3 ubiquitin-protein ligase HUL5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HUL5 PE=1 SV=1
6	O13834	2.04e-55	214	3227	0.126	0.042	PTR1_SCHPO E3 ubiquitin-protein ligase ptr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ptr1 PE=1 SV=1
7	Q8H0T4	2.06e-52	204	3658	0.128	0.038	UPL2_ARATH E3 ubiquitin-protein ligase UPL2 OS=Arabidopsis thaliana OX=3702 GN=UPL2 PE=1 SV=3
8	Q8GY23	2.61e-52	204	3681	0.129	0.038	UPL1_ARATH E3 ubiquitin-protein ligase UPL1 OS=Arabidopsis thaliana OX=3702 GN=UPL1 PE=1 SV=3
9	Q05086	2.95e-52	201	875	0.131	0.162	UBE3A_HUMAN Ubiquitin-protein ligase E3A OS=Homo sapiens OX=9606 GN=UBE3A PE=1 SV=4
10	O08759	8.22e-52	199	870	0.131	0.163	UBE3A_MOUSE Ubiquitin-protein ligase E3A OS=Mus musculus OX=10090 GN=Ube3a PE=1 SV=2
11	F1M7B8	1.18e-51	199	868	0.131	0.164	F1M7B8_RAT Ubiquitin-protein ligase E3A OS=Rattus norvegicus OX=10116 GN=Ube3a PE=1 SV=2
12	A0A8I5ZM14	1.51e-51	198	867	0.131	0.164	A0A8I5ZM14_RAT Ubiquitin-protein ligase E3A OS=Rattus norvegicus OX=10116 GN=Ube3a PE=1 SV=1
13	Q5U1Z5	1.70e-50	187	440	0.118	0.291	Q5U1Z5_RAT HECT-type E3 ubiquitin transferase OS=Rattus norvegicus OX=10116 GN=Nedd4l PE=2 SV=1
14	O14326	2.86e-49	190	786	0.117	0.162	PUB3_SCHPO E3 ubiquitin-protein ligase pub3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pub3 PE=2 SV=1
15	F8W2M1	4.84e-49	191	904	0.123	0.147	HACE1_DANRE E3 ubiquitin-protein ligase HACE1 OS=Danio rerio OX=7955 GN=hace1 PE=3 SV=2
16	F1LRN8	1.81e-48	189	856	0.119	0.151	F1LRN8_RAT E3 ubiquitin-protein ligase OS=Rattus norvegicus OX=10116 GN=Nedd4l PE=1 SV=4
17	A0A0G2JUY1	2.42e-48	189	921	0.119	0.140	A0A0G2JUY1_RAT E3 ubiquitin-protein ligase OS=Rattus norvegicus OX=10116 GN=Nedd4l PE=1 SV=2
18	A0A8I6A6J7	3.02e-48	189	921	0.119	0.140	A0A8I6A6J7_RAT E3 ubiquitin-protein ligase OS=Rattus norvegicus OX=10116 GN=Nedd4l PE=1 SV=1
19	A0A8I6GKS9	3.40e-48	189	942	0.119	0.137	A0A8I6GKS9_RAT E3 ubiquitin-protein ligase OS=Rattus norvegicus OX=10116 GN=Nedd4l PE=1 SV=1
20	Q8IYU2	6.17e-48	187	909	0.117	0.140	HACE1_HUMAN E3 ubiquitin-protein ligase HACE1 OS=Homo sapiens OX=9606 GN=HACE1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00632 HECT	4.7e-89	310.5	HECT-domain (ubiquitin-transferase)
2	PF00612 IQ	1.2	20.1	IQ calmodulin-binding motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000309198

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000363019	0.942	Ubiquitin-conjugating enzyme E2 D1
2	9606.ENSP00000386541	0.922	26S proteasome non-ATPase regulatory subunit 14
3	9606.ENSP00000441543	0.910	Polyubiquitin-C
4	9606.ENSP00000400906	0.863	Ubiquitin-conjugating enzyme E2L 3
5	9606.ENSP00000261601	0.855	Ubiquitin carboxyl-terminal hydrolase 14
6	9606.ENSP00000381717	0.824	Ubiquitin-conjugating enzyme E2 D2
7	9606.ENSP00000349722	0.811	Ubiquitin conjugating enzyme E2 D3
8	9606.ENSP00000385285	0.810	RING finger protein 32
9	9606.ENSP00000478877	0.789	Proteasomal ubiquitin receptor ADRM1
10	9606.ENSP00000310129	0.770	26S proteasome non-ATPase regulatory subunit 2
11	9606.ENSP00000357879	0.766	26S proteasome non-ATPase regulatory subunit 4
12	9606.ENSP00000290650	0.748	E3 ubiquitin-protein ligase UBR1
13	9606.ENSP00000380251	0.711	Nucleoside diphosphate-linked moiety X motif 19
14	9606.ENSP00000343001	0.706	Ubiquitin conjugation factor E4 B
15	9606.ENSP00000387362	0.694	Ubiquitin conjugation factor E4 A
16	9606.ENSP00000261712	0.684	26S proteasome non-ATPase regulatory subunit 11
17	9606.ENSP00000361990	0.684	E3 ubiquitin-protein ligase UBR2
18	9606.ENSP00000478783	0.680	E3 ubiquitin-protein ligase listerin
19	9606.ENSP00000259335	0.678	Proteasome-associated protein ECM29 homolog
20	9606.ENSP00000373696	0.675	E3 ubiquitin-protein ligase TRIP12

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0061630	1.000	ubiquitin protein ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044238	0.996	primary metabolic process
GO:0019538	0.989	protein metabolic process
GO:0016567	0.959	protein ubiquitination
GO:0070936	0.863	protein K48-linked ubiquitination
GO:0009987	0.817	cellular process
GO:0065007	0.761	biological regulation
GO:0050789	0.750	regulation of biological process
GO:0050794	0.622	regulation of cellular process
GO:0044237	0.520	cellular metabolic process
GO:0006508	0.382	proteolysis
GO:0050896	0.377	response to stimulus
GO:0051603	0.360	proteolysis involved in protein catabolic process
GO:0044260	0.335	cellular macromolecule metabolic process
GO:0019222	0.333	regulation of metabolic process
GO:0048518	0.318	positive regulation of biological process
GO:0060255	0.315	regulation of macromolecule metabolic process
GO:0044248	0.302	cellular catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0031981	0.995	nuclear lumen
GO:0016020	0.982	membrane
GO:0012505	0.973	endomembrane system
GO:0005654	0.903	nucleoplasm
GO:0032991	0.760	protein-containing complex
GO:0043232	0.338	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]