StarFunc result for job id Q15389

User Input

>input (498 residues)
MTVFLSFAFLAAILTHIGCSNQRRSPENSGRRYNRIQHGQCAYTFILPEHDGNCRESTTD
QYNTNALQRDAPHVEPDFSSQKLQHLEHVMENYTQWLQKLENYIVENMKSEMAQIQQNAV
QNHTATMLEIGTSLLSQTAEQTRKLTDVETQVLNQTSRLEIQLLENSLSTYKLEKQLLQQ
TNEILKIHEKNSLLEHKILEMEGKHKEELDTLKEEKENLQGLVTRQTYIIQELEKQLNRA
TTNNSVLQKQQLELMDTVHNLVNLCTKEGVLLKGGKREEEKPFRDCADVYQAGFNKSGIY
TIYINNMPEPKKVFCNMDVNGGGWTVIQHREDGSLDFQRGWKEYKMGFGNPSGEYWLGNE
FIFAITSQRQYMLRIELMDWEGNRAYSQYDRFHIGNEKQNYRLYLKGHTGTAGKQSSLIL
HGADFSTKDADNDNCMCKCALMLTGGWWFDACGPSNLNGMFYTAGQNHGKLNGIKWHYFK
GPSYSLRSTTMMIRPLDF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O08538	0.764	0.764	6.315E-77	498	0.974	0.974	O08538.pdb.gz	ANGP1_MOUSE Angiopoietin-1 OS=Mus musculus OX=10090 GN=Angpt1 PE=1 SV=2
2	AFDB:B3DJK2	0.504	0.493	1.412E-56	513	0.673	0.653	B3DJK2.pdb.gz
3	AFDB:O15123	0.532	0.534	7.174E-55	496	0.600	0.603	O15123.pdb.gz	ANGP2_HUMAN Angiopoietin-2 OS=Homo sapiens OX=9606 GN=ANGPT2 PE=1 SV=1
4	AFDB:O35462	0.824	0.827	9.299E-54	496	0.584	0.587	O35462.pdb.gz	ANGP2_RAT Angiopoietin-2 OS=Rattus norvegicus OX=10116 GN=Angpt2 PE=2 SV=2
5	AFDB:Q1LWR7	0.439	0.447	1.036E-46	489	0.506	0.515	Q1LWR7.pdb.gz
6	AFDB:Q9Y264	0.463	0.459	3.837E-46	503	0.456	0.451	Q9Y264.pdb.gz	ANGP4_HUMAN Angiopoietin-4 OS=Homo sapiens OX=9606 GN=ANGPT4 PE=1 SV=1
7	AFDB:Q9WVH6	0.562	0.554	1.889E-45	509	0.470	0.460	Q9WVH6.pdb.gz	ANGP4_MOUSE Angiopoietin-4 OS=Mus musculus OX=10090 GN=Angpt4 PE=1 SV=1
8	AFDB:Q5KQU0	0.416	0.432	6.961E-29	480	0.267	0.277	Q5KQU0.pdb.gz	Q5KQU0_DANRE Angiopoietin-like 1 OS=Danio rerio OX=7955 GN=Angptl1 PE=2 SV=1
9	AFDB:O43827	0.416	0.594	2.729E-28	346	0.223	0.321	O43827.pdb.gz	ANGL7_HUMAN Angiopoietin-related protein 7 OS=Homo sapiens OX=9606 GN=ANGPTL7 PE=1 SV=1
10	AFDB:Q14314	0.424	0.479	4.556E-28	439	0.225	0.255	Q14314.pdb.gz	FGL2_HUMAN Fibroleukin OS=Homo sapiens OX=9606 GN=FGL2 PE=1 SV=1
11	PDB:1jc9A	0.420	0.935	2.958E-26	220	0.185	0.418	1jc9A.pdb.gz	The 2.0-A crystal structure of tachylectin 5A provides evidence for the common origin of the innate immunity and the blood coagulation systems.
12	PDB:1m1jB	0.412	0.508	2.510E-24	402	0.213	0.264	1m1jB.pdb.gz	Crystal Structure of Native Chicken Fibrinogen at 2.7 A Resolution
13	PDB:3ghgB	0.412	0.510	2.184E-23	401	0.191	0.237	3ghgB.pdb.gz	Crystal structure of human fibrinogen.
14	PDB:1ei3C	0.402	0.501	3.253E-23	397	0.225	0.282	1ei3C.pdb.gz
15	PDB:3ghgI	0.404	0.507	8.350E-22	394	0.217	0.274	3ghgI.pdb.gz	Crystal structure of human fibrinogen.
16	PDB:5zc0A	0.223	0.351	9.074E-5	281	0.084	0.149	5zc0A.pdb.gz	Structural stabilities of calcium proteins: Human intelectin-1 and frog lectin XEEL
17	PDB:4wmqA	0.232	0.363	1.352E-4	283	0.068	0.120	4wmqA.pdb.gz	Recognition of microbial glycans by human intelectin-1.
18	PDB:7fdeP	0.144	0.331	6.699E-2	181	0.042	0.116	7fdeP.pdb.gz
19	PDB:4qvbB	0.072	0.212	8.203E-1	144	0.010	0.035	4qvbB.pdb.gz	Molecular insights into the binding of coenzyme F420 to the conserved protein Rv1155 from Mycobacterium tuberculosis.
20	PDB:7r7jB	0.056	0.050	9.730E-1	574	0.022	0.019	7r7jB.pdb.gz	X-ray crystal structure of the Escherichia coli RadD DNA repair protein bound to ADP reveals a novel zinc ribbon domain.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O08538	0.0	1026	498	0.974	0.974	ANGP1_MOUSE Angiopoietin-1 OS=Mus musculus OX=10090 GN=Angpt1 PE=1 SV=2
2	O15123	0.0	614	496	0.600	0.603	ANGP2_HUMAN Angiopoietin-2 OS=Homo sapiens OX=9606 GN=ANGPT2 PE=1 SV=1
3	O35460	0.0	1013	497	0.970	0.972	ANGP1_RAT Angiopoietin-1 OS=Rattus norvegicus OX=10116 GN=Angpt1 PE=2 SV=2
4	O35462	0.0	603	496	0.588	0.591	ANGP2_RAT Angiopoietin-2 OS=Rattus norvegicus OX=10116 GN=Angpt2 PE=2 SV=2
5	O35608	0.0	615	496	0.594	0.597	ANGP2_MOUSE Angiopoietin-2 OS=Mus musculus OX=10090 GN=Angpt2 PE=2 SV=2
6	Q15389	0.0	1046	498	1.000	1.000	ANGP1_HUMAN Angiopoietin-1 OS=Homo sapiens OX=9606 GN=ANGPT1 PE=1 SV=2
7	Q90Z19	0.0	690	513	0.667	0.647	Q90Z19_DANRE Angiopoietin-1 OS=Danio rerio OX=7955 GN=ang1 PE=2 SV=1
8	Q90Z18	6.14e-179	513	489	0.516	0.526	Q90Z18_DANRE Angiopoietin-2 OS=Danio rerio OX=7955 GN=ang2 PE=2 SV=1
9	Q9WVH6	5.94e-154	450	509	0.470	0.460	ANGP4_MOUSE Angiopoietin-4 OS=Mus musculus OX=10090 GN=Angpt4 PE=1 SV=1
10	Q9Y264	5.46e-152	445	503	0.454	0.449	ANGP4_HUMAN Angiopoietin-4 OS=Homo sapiens OX=9606 GN=ANGPT4 PE=1 SV=1
11	O43827	3.63e-63	211	346	0.197	0.283	ANGL7_HUMAN Angiopoietin-related protein 7 OS=Homo sapiens OX=9606 GN=ANGPTL7 PE=1 SV=1
12	Q5KQU0	5.61e-63	214	480	0.299	0.310	Q5KQU0_DANRE Angiopoietin-like 1 OS=Danio rerio OX=7955 GN=Angptl1 PE=2 SV=1
13	O95841	7.39e-63	214	491	0.317	0.322	ANGL1_HUMAN Angiopoietin-related protein 1 OS=Homo sapiens OX=9606 GN=ANGPTL1 PE=2 SV=1
14	Q5RH53	8.44e-63	214	480	0.299	0.310	Q5RH53_DANRE Angiopoietin-like 1a OS=Danio rerio OX=7955 GN=angptl1 PE=4 SV=1
15	Q640P2	4.01e-61	209	490	0.307	0.312	ANGL1_MOUSE Angiopoietin-related protein 1 OS=Mus musculus OX=10090 GN=Angptl1 PE=2 SV=1
16	Q9R045	1.07e-56	198	493	0.245	0.247	ANGL2_MOUSE Angiopoietin-related protein 2 OS=Mus musculus OX=10090 GN=Angptl2 PE=2 SV=2
17	Q9UKU9	4.29e-55	194	493	0.243	0.245	ANGL2_HUMAN Angiopoietin-related protein 2 OS=Homo sapiens OX=9606 GN=ANGPTL2 PE=1 SV=1
18	Q5KQT9	1.18e-54	193	510	0.299	0.292	Q5KQT9_DANRE Angiopoietin-like 2 OS=Danio rerio OX=7955 GN=Angptl2 PE=2 SV=1
19	B0UXH5	2.38e-54	192	519	0.299	0.287	B0UXH5_DANRE Angiopoietin-like 2b OS=Danio rerio OX=7955 GN=angptl2 PE=4 SV=1
20	Q08830	4.66e-54	186	312	0.209	0.333	FGL1_HUMAN Fibrinogen-like protein 1 OS=Homo sapiens OX=9606 GN=FGL1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00147 Fibrinogen_C	1.2e-66	236.2	Fibrinogen beta and gamma chains, C-terminal globular domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000428340

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000369375	0.999	Angiopoietin-1 receptor
2	9606.ENSP00000431418	0.995	High affinity nerve growth factor receptor
3	9606.ENSP00000346839	0.966	Fibronectin type III domain containing
4	9606.ENSP00000219070	0.952	72 kDa type IV collagenase
5	9606.ENSP00000308938	0.951	Plasminogen
6	9606.ENSP00000478570	0.951	Vascular endothelial growth factor A
7	9606.ENSP00000379350	0.945	Integrin beta-1
8	9606.ENSP00000321203	0.941	TNFAIP3-interacting protein 2
9	9606.ENSP00000293379	0.935	Integrin alpha-5
10	9606.ENSP00000401303	0.930	SHC-transforming protein 1
11	9606.ENSP00000407586	0.922	GTPase HRas
12	9606.ENSP00000340944	0.921	Tyrosine-protein phosphatase non-receptor type 11
13	9606.ENSP00000256078	0.918	GTPase KRas
14	9606.ENSP00000274376	0.916	Ras GTPase-activating protein 1
15	9606.ENSP00000376345	0.915	Growth factor receptor-bound protein 2
16	9606.ENSP00000417273	0.915	Cytoplasmic protein NCK1
17	9606.ENSP00000428056	0.915	Phosphatidylinositol 3-kinase regulatory subunit alpha
18	9606.ENSP00000229795	0.914	Mitogen-activated protein kinase 14
19	9606.ENSP00000276420	0.913	Docking protein 2
20	9606.ENSP00000263967	0.912	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	0.998	identical protein binding
GO:0030971	0.996	receptor tyrosine kinase binding
GO:0005126	0.922	cytokine receptor binding
GO:0070851	0.912	growth factor receptor binding
GO:0005172	0.875	vascular endothelial growth factor receptor binding
GO:0098772	0.378	molecular function regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.994	response to stimulus
GO:0050794	0.994	regulation of cellular process
GO:0032501	0.992	multicellular organismal process
GO:0048856	0.991	anatomical structure development
GO:0009987	0.983	cellular process
GO:0048731	0.981	system development
GO:0048523	0.975	negative regulation of cellular process
GO:0019222	0.963	regulation of metabolic process
GO:0060255	0.950	regulation of macromolecule metabolic process
GO:0080090	0.947	regulation of primary metabolic process
GO:0051171	0.947	regulation of nitrogen compound metabolic process
GO:0048522	0.947	positive regulation of cellular process
GO:0031323	0.946	regulation of cellular metabolic process
GO:0010646	0.944	regulation of cell communication
GO:0023051	0.941	regulation of signaling
GO:0030335	0.923	positive regulation of cell migration
GO:0072359	0.902	circulatory system development
GO:0001568	0.884	blood vessel development
GO:0051239	0.878	regulation of multicellular organismal process
GO:0010941	0.870	regulation of cell death
GO:0048513	0.869	animal organ development
GO:0071704	0.866	organic substance metabolic process
GO:0009966	0.848	regulation of signal transduction
GO:0009893	0.840	positive regulation of metabolic process
GO:0010594	0.838	regulation of endothelial cell migration
GO:0051174	0.831	regulation of phosphorus metabolic process
GO:0030155	0.824	regulation of cell adhesion
GO:0051246	0.821	regulation of protein metabolic process
GO:0007166	0.817	cell surface receptor signaling pathway
GO:0010033	0.814	response to organic substance
GO:0060548	0.812	negative regulation of cell death
GO:0040013	0.804	negative regulation of locomotion
GO:0042981	0.801	regulation of apoptotic process
GO:0010604	0.793	positive regulation of macromolecule metabolic process
GO:0043066	0.784	negative regulation of apoptotic process
GO:0031399	0.777	regulation of protein modification process
GO:0009653	0.769	anatomical structure morphogenesis
GO:0048584	0.754	positive regulation of response to stimulus
GO:0044238	0.735	primary metabolic process
GO:0032879	0.735	regulation of localization
GO:0031325	0.730	positive regulation of cellular metabolic process
GO:0043535	0.722	regulation of blood vessel endothelial cell migration
GO:0042127	0.721	regulation of cell population proliferation
GO:0009719	0.708	response to endogenous stimulus
GO:0007167	0.705	enzyme-linked receptor protein signaling pathway
GO:0019220	0.697	regulation of phosphate metabolic process
GO:0043170	0.679	macromolecule metabolic process
GO:0051173	0.679	positive regulation of nitrogen compound metabolic process
GO:0045937	0.669	positive regulation of phosphate metabolic process
GO:0042325	0.657	regulation of phosphorylation
GO:0035295	0.628	tube development
GO:0001934	0.626	positive regulation of protein phosphorylation
GO:1902531	0.619	regulation of intracellular signal transduction
GO:0065009	0.615	regulation of molecular function
GO:0009628	0.601	response to abiotic stimulus
GO:0006950	0.598	response to stress
GO:0007169	0.588	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0006807	0.571	nitrogen compound metabolic process
GO:0001822	0.571	kidney development
GO:0050793	0.561	regulation of developmental process
GO:0023056	0.552	positive regulation of signaling
GO:0010647	0.552	positive regulation of cell communication
GO:0065008	0.540	regulation of biological quality
GO:0050790	0.537	regulation of catalytic activity
GO:1902533	0.533	positive regulation of intracellular signal transduction
GO:0022414	0.511	reproductive process
GO:0051241	0.511	negative regulation of multicellular organismal process
GO:0051240	0.506	positive regulation of multicellular organismal process
GO:0010634	0.504	positive regulation of epithelial cell migration
GO:0072006	0.483	nephron development
GO:0010468	0.482	regulation of gene expression
GO:0009605	0.464	response to external stimulus
GO:0044093	0.447	positive regulation of molecular function
GO:0051049	0.430	regulation of transport
GO:0008284	0.414	positive regulation of cell population proliferation
GO:0070887	0.412	cellular response to chemical stimulus
GO:0044237	0.386	cellular metabolic process
GO:0050730	0.355	regulation of peptidyl-tyrosine phosphorylation
GO:2000146	0.346	negative regulation of cell motility
GO:0035239	0.343	tube morphogenesis
GO:0031326	0.328	regulation of cellular biosynthetic process
GO:0019219	0.327	regulation of nucleobase-containing compound metabolic process
GO:1901564	0.322	organonitrogen compound metabolic process
GO:0051128	0.320	regulation of cellular component organization
GO:0009892	0.320	negative regulation of metabolic process
GO:0030154	0.317	cell differentiation
GO:0010556	0.317	regulation of macromolecule biosynthetic process
GO:0010605	0.313	negative regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.999	extracellular space
GO:0043226	0.950	organelle
GO:0071944	0.929	cell periphery
GO:0043227	0.919	membrane-bounded organelle
GO:0016020	0.863	membrane
GO:0005886	0.751	plasma membrane
GO:0031982	0.595	vesicle
GO:0005622	0.541	intracellular anatomical structure
GO:0005737	0.512	cytoplasm
GO:0043231	0.490	intracellular membrane-bounded organelle
GO:0070062	0.426	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]