StarFunc result for job id Q15393

User Input

>input (1217 residues)
MFLYNLTLQRATGISFAIHGNFSGTKQQEIVVSRGKILELLRPDPNTGKVHTLLTVEVFG
VIRSLMAFRLTGGTKDYIVVGSDSGRIVILEYQPSKNMFEKIHQETFGKSGCRRIVPGQF
LAVDPKGRAVMISAIEKQKLVYILNRDAAARLTISSPLEAHKANTLVYHVVGVDVGFENP
MFACLEMDYEEADNDPTGEAAANTQQTLTFYELDLGLNHVVRKYSEPLEEHGNFLITVPG
GSDGPSGVLICSENYITYKNFGDQPDIRCPIPRRRNDLDDPERGMIFVCSATHKTKSMFF
FLAQTEQGDIFKITLETDEDMVTEIRLKYFDTVPVAAAMCVLKTGFLFVASEFGNHYLYQ
IAHLGDDDEEPEFSSAMPLEEGDTFFFQPRPLKNLVLVDELDSLSPILFCQIADLANEDT
PQLYVACGRGPRSSLRVLRHGLEVSEMAVSELPGNPNAVWTVRRHIEDEFDAYIIVSFVN
ATLVLSIGETVEEVTDSGFLGTTPTLSCSLLGDDALVQVYPDGIRHIRADKRVNEWKTPG
KKTIVKCAVNQRQVVIALTGGELVYFEMDPSGQLNEYTERKEMSADVVCMSLANVPPGEQ
RSRFLAVGLVDNTVRIISLDPSDCLQPLSMQALPAQPESLCIVEMGGTEKQDELGERGSI
GFLYLNIGLQNGVLLRTVLDPVTGDLSDTRTRYLGSRPVKLFRVRMQGQEAVLAMSSRSW
LSYSYQSRFHLTPLSYETLEFASGFASEQCPEGIVAISTNTLRILALEKLGAVFNQVAFP
LQYTPRKFVIHPESNNLIIIETDHNAYTEATKAQRKQQMAEEMVEAAGEDERELAAEMAA
AFLNENLPESIFGAPKAGNGQWASVIRVMNPIQGNTLDLVQLEQNEAAFSVAVCRFSNTG
EDWYVLVGVAKDLILNPRSVAGGFVYTYKLVNNGEKLEFLHKTPVEEVPAAIAPFQGRVL
IGVGKLLRVYDLGKKKLLRKCENKHIANYISGIQTIGHRVIVSDVQESFIWVRYKRNENQ
LIIFADDTYPRWVTTASLLDYDTVAGADKFGNICVVRLPPNTNDEVDEDPTGNKALWDRG
LLNGASQKAEVIMNYHVGETVLSLQKTTLIPGGSESLVYTTLSGGIGILVPFTSHEDHDF
FQHVEMHLRSEHPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNSMEPNKQKNVSEELDRT
PPEVSKKLEDIRTRYAF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:5o9zw	0.815	0.866	0.000	1140	0.928	0.990	5o9zw.pdb.gz	Cryo-EM Structure of a Pre-catalytic Human Spliceosome Primed for Activation.
2	PDB:7dvq3	0.964	0.983	0.000	1193	0.980	1.000	7dvq3.pdb.gz	Structure of the activated human minor spliceosome.
3	PDB:7q4pC	0.715	0.989	0.000	878	0.717	0.994	7q4pC.pdb.gz	Structural basis of branch site recognition by the human spliceosome.
4	AFDB:P0DKL4	0.943	0.945	0.000	1214	0.577	0.578	P0DKL4.pdb.gz	S130A_ARATH Spliceosome-associated protein 130 A OS=Arabidopsis thaliana OX=3702 GN=SAP130A PE=2 SV=1
5	AFDB:Q15393	1.000	1.000	0.000	1217	1.000	1.000	Q15393.pdb.gz	SF3B3_HUMAN Splicing factor 3B subunit 3 OS=Homo sapiens OX=9606 GN=SF3B3 PE=1 SV=4
6	AFDB:Q9UTT2	0.908	0.916	0.000	1206	0.459	0.463	Q9UTT2.pdb.gz	RSE1_SCHPO Pre-mRNA-splicing factor prp12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=prp12 PE=1 SV=1
7	AFDB:Q9W0M7	0.991	0.983	0.000	1227	0.758	0.752	Q9W0M7.pdb.gz	SF3B3_DROME Splicing factor 3B subunit 3 OS=Drosophila melanogaster OX=7227 GN=Sf3b3 PE=1 SV=2
8	PDB:5lqwX	0.778	0.858	4.799E-87	1095	0.203	0.226	5lqwX.pdb.gz	Molecular architecture of the Saccharomyces cerevisiae activated spliceosome
9	AFDB:Q04693	0.726	0.658	6.133E-87	1361	0.250	0.223	Q04693.pdb.gz	RSE1_YEAST Pre-mRNA-splicing factor RSE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RSE1 PE=1 SV=1
10	AFDB:Q6L4S0	0.761	0.842	4.824E-82	1090	0.212	0.237	Q6L4S0.pdb.gz	DDB1_ORYSJ DNA damage-binding protein 1 OS=Oryza sativa subsp. japonica OX=39947 GN=DBB1 PE=1 SV=1
11	AFDB:O49552	0.765	0.848	1.909E-80	1088	0.207	0.232	O49552.pdb.gz	DDB1B_ARATH DNA damage-binding protein 1b OS=Arabidopsis thaliana OX=3702 GN=DDB1B PE=1 SV=2
12	AFDB:Q9XYZ5	0.745	0.791	5.615E-78	1140	0.205	0.219	Q9XYZ5.pdb.gz	DDB1_DROME DNA damage-binding protein 1 OS=Drosophila melanogaster OX=7227 GN=pic PE=1 SV=1
13	AFDB:B0M0P5	0.757	0.778	4.174E-77	1181	0.201	0.207	B0M0P5.pdb.gz	DDB1_DICDI DNA damage-binding protein 1 OS=Dictyostelium discoideum OX=44689 GN=repE PE=1 SV=1
14	PDB:5nrlP	0.750	0.767	8.095E-77	1186	0.249	0.255	5nrlP.pdb.gz	Structure of a pre-catalytic spliceosome.
15	AFDB:A1A4K3	0.731	0.776	8.964E-77	1140	0.212	0.226	A1A4K3.pdb.gz	DDB1_BOVIN DNA damage-binding protein 1 OS=Bos taurus OX=9913 GN=DDB1 PE=1 SV=1
16	PDB:6xk9Y	0.667	0.724	1.098E-73	1106	0.210	0.231	6xk9Y.pdb.gz	CC-90009, a novel cereblon E3 ligase modulator, targets acute myeloid leukemia blasts and leukemia stem cells.
17	PDB:2hyeA	0.602	0.639	3.802E-73	1140	0.207	0.221	2hyeA.pdb.gz	Molecular architecture and assembly of the DDB1-CUL4A ubiquitin ligase machinery.
18	PDB:5hxbY	0.663	0.734	4.780E-72	1080	0.208	0.234	5hxbY.pdb.gz	A novel cereblon modulator recruits GSPT1 to the CRL4(CRBN) ubiquitin ligase.
19	PDB:7uknA	0.689	0.781	8.895E-72	1059	0.201	0.231	7uknA.pdb.gz	Insight into Viral Hijacking of CRL4 Ubiquitin Ligase through Structural Analysis of the pUL145-DDB1 Complex.
20	PDB:3e0cA	0.688	0.815	3.519E-70	1011	0.205	0.246	3e0cA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P0DKL4	0.0	1457	1214	0.582	0.583	S130A_ARATH Spliceosome-associated protein 130 A OS=Arabidopsis thaliana OX=3702 GN=SAP130A PE=2 SV=1
2	P0DKL6	0.0	1457	1214	0.582	0.583	S130B_ARATH Spliceosome-associated protein 130 B OS=Arabidopsis thaliana OX=3702 GN=SAP130B PE=2 SV=1
3	Q15393	0.0	2524	1217	1.000	1.000	SF3B3_HUMAN Splicing factor 3B subunit 3 OS=Homo sapiens OX=9606 GN=SF3B3 PE=1 SV=4
4	Q8T9L6	0.0	927	688	0.360	0.637	Q8T9L6_DROME GM01240p OS=Drosophila melanogaster OX=7227 GN=Sf3b3 PE=2 SV=1
5	Q9UTT2	0.0	1055	1206	0.459	0.463	RSE1_SCHPO Pre-mRNA-splicing factor prp12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=prp12 PE=1 SV=1
6	Q9W0M7	0.0	1966	1227	0.758	0.751	SF3B3_DROME Splicing factor 3B subunit 3 OS=Drosophila melanogaster OX=7227 GN=Sf3b3 PE=1 SV=2
7	Q04693	1.38e-91	325	1361	0.284	0.254	RSE1_YEAST Pre-mRNA-splicing factor RSE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RSE1 PE=1 SV=1
8	Q6L4S0	5.78e-61	230	1090	0.234	0.261	DDB1_ORYSJ DNA damage-binding protein 1 OS=Oryza sativa subsp. japonica OX=39947 GN=DBB1 PE=1 SV=1
9	F6VLN2	4.08e-56	215	1127	0.232	0.250	F6VLN2_XENTR DNA damage-binding protein 1 OS=Xenopus tropicalis OX=8364 GN=ddb1 PE=3 SV=4
10	O49552	3.75e-55	212	1088	0.233	0.261	DDB1B_ARATH DNA damage-binding protein 1b OS=Arabidopsis thaliana OX=3702 GN=DDB1B PE=1 SV=2
11	Q805F9	5.30e-55	212	1140	0.235	0.251	DDB1_CHICK DNA damage-binding protein 1 OS=Gallus gallus OX=9031 GN=DDB1 PE=1 SV=1
12	Q9XYZ5	5.94e-55	211	1140	0.224	0.239	DDB1_DROME DNA damage-binding protein 1 OS=Drosophila melanogaster OX=7227 GN=pic PE=1 SV=1
13	Q16531	7.72e-55	211	1140	0.233	0.249	DDB1_HUMAN DNA damage-binding protein 1 OS=Homo sapiens OX=9606 GN=DDB1 PE=1 SV=1
14	Q9ESW0	8.65e-55	211	1140	0.234	0.250	DDB1_RAT DNA damage-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Ddb1 PE=1 SV=1
15	Q9M0V3	9.21e-55	211	1088	0.233	0.260	DDB1A_ARATH DNA damage-binding protein 1a OS=Arabidopsis thaliana OX=3702 GN=DDB1A PE=1 SV=1
16	A1A4K3	1.58e-54	210	1140	0.233	0.249	DDB1_BOVIN DNA damage-binding protein 1 OS=Bos taurus OX=9913 GN=DDB1 PE=1 SV=1
17	Q3U1J4	6.52e-54	208	1140	0.233	0.248	DDB1_MOUSE DNA damage-binding protein 1 OS=Mus musculus OX=10090 GN=Ddb1 PE=1 SV=2
18	B0M0P5	4.69e-47	186	1181	0.230	0.237	DDB1_DICDI DNA damage-binding protein 1 OS=Dictyostelium discoideum OX=44689 GN=repE PE=1 SV=1
19	Q6PGT6	3.26e-41	167	897	0.187	0.254	Q6PGT6_DANRE DNA damage-binding protein 1 OS=Danio rerio OX=7955 GN=zgc:63840 PE=1 SV=1
20	Q21554	2.89e-33	142	1134	0.205	0.220	DDB1_CAEEL DNA damage-binding protein 1 OS=Caenorhabditis elegans OX=6239 GN=ddb-1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03178 CPSF_A	1.6e-98	341.6	CPSF A subunit region
2	PF10433 MMS1_N	4.4e-178	604.6	Mono-functional DNA-alkylating methyl methanesulfonate N-term

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1026970.XP_008833202.1

Rank	PPI partner	STRING score	Description
1	1026970.XP_008820468.1	0.999	Splicing factor 3b subunit 2
2	1026970.XP_008828032.1	0.999	Splicing factor 3B subunit 5
3	1026970.XP_008836433.1	0.999	Elongation factor Tu GTP binding domain containing 2
4	1026970.XP_008841952.1	0.999	Splicing factor 3b subunit 4
5	1026970.XP_008843025.1	0.999	PHD finger-like domain-containing protein 5A
6	1026970.XP_008846510.1	0.999	Splicing factor 3B subunit 1 isoform X1
7	1026970.XP_008847001.1	0.999	Splicing factor 3b subunit 6
8	1026970.XP_008854400.1	0.999	CWC27 spliceosome associated protein homolog
9	1026970.XP_008827006.1	0.998	pre-mRNA-processing-splicing factor 8
10	1026970.XP_008835329.1	0.998	Splicing factor 3A subunit 2
11	1026970.XP_008836334.1	0.998	U5 small nuclear ribonucleoprotein 200 kDa helicase
12	1026970.XP_008847764.1	0.998	Small nuclear ribonucleoprotein polypeptide A
13	1026970.XP_008839283.1	0.997	Splicing factor 3a subunit 1
14	1026970.XP_008841538.1	0.997	pre-mRNA-processing factor 6 isoform X1
15	1026970.XP_008836103.1	0.996	Small nuclear ribonucleoprotein Sm D3
16	1026970.XP_008848445.1	0.996	Splicing factor 3a subunit 3
17	1026970.XP_008825190.1	0.995	Small nuclear ribonucleoprotein D1 polypeptide
18	1026970.XP_008842763.1	0.995	XPA binding protein 2
19	1026970.XP_008850270.1	0.995	Small nuclear ribonucleoprotein Sm D2
20	1026970.XP_008820502.1	0.994	Squamous cell carcinoma antigen recognized by T-cells 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044877	1.000	protein-containing complex binding
GO:0005515	1.000	protein binding
GO:0003676	0.499	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044238	0.997	primary metabolic process
GO:0044237	0.997	cellular metabolic process
GO:0006807	0.995	nitrogen compound metabolic process
GO:0006396	0.988	RNA processing
GO:0006397	0.983	mRNA processing
GO:0008380	0.974	RNA splicing
GO:0000398	0.957	mRNA splicing, via spliceosome
GO:0065007	0.515	biological regulation
GO:0050789	0.513	regulation of biological process
GO:0019222	0.364	regulation of metabolic process
GO:0060255	0.350	regulation of macromolecule metabolic process
GO:0080090	0.326	regulation of primary metabolic process
GO:0051171	0.325	regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	0.998	intracellular non-membrane-bounded organelle
GO:0005654	0.998	nucleoplasm
GO:0071013	0.995	catalytic step 2 spliceosome
GO:0071011	0.992	precatalytic spliceosome
GO:0005684	0.881	U2-type spliceosomal complex
GO:0005737	0.695	cytoplasm
GO:0005730	0.692	nucleolus
GO:0005689	0.588	U12-type spliceosomal complex
GO:0071005	0.548	U2-type precatalytic spliceosome
GO:0097525	0.401	spliceosomal snRNP complex
GO:1990234	0.380	transferase complex
GO:0140535	0.360	intracellular protein-containing complex
GO:0000785	0.354	chromatin

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]