StarFunc result for job id Q15399

User Input

>input (786 residues)
MTSIFHFAIIFMLILQIRIQLSEESEFLVDRSKNGLIHVPKDLSQKTTILNISQNYISEL
WTSDILSLSKLRILIISHNRIQYLDISVFKFNQELEYLDLSHNKLVKISCHPTVNLKHLD
LSFNAFDALPICKEFGNMSQLKFLGLSTTHLEKSSVLPIAHLNISKVLLVLGETYGEKED
PEGLQDFNTESLHIVFPTNKEFHFILDVSVKTVANLELSNIKCVLEDNKCSYFLSILAKL
QTNPKLSNLTLNNIETTWNSFIRILQLVWHTTVWYFSISNVKLQGQLDFRDFDYSGTSLK
ALSIHQVVSDVFGFPQSYIYEIFSNMNIKNFTVSGTRMVHMLCPSKISPFLHLDFSNNLL
TDTVFENCGHLTELETLILQMNQLKELSKIAEMTTQMKSLQQLDISQNSVSYDEKKGDCS
WTKSLLSLNMSSNILTDTIFRCLPPRIKVLDLHSNKIKSIPKQVVKLEALQELNVAFNSL
TDLPGCGSFSSLSVLIIDHNSVSHPSADFFQSCQKMRSIKAGDNPFQCTCELGEFVKNID
QVSSEVLEGWPDSYKCDYPESYRGTLLKDFHMSELSCNITLLIVTIVATMLVLAVTVTSL
CSYLDLPWYLRMVCQWTQTRRRARNIPLEELQRNLQFHAFISYSGHDSFWVKNELLPNLE
KEGMQICLHERNFVPGKSIVENIITCIEKSYKSIFVLSPNFVQSEWCHYELYFAHHNLFH
EGSNSLILILLEPIPQYSIPSSYHKLKSLMARRTYLEWPKEKSKRGLFWANLRAAINIKL
TEQAKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15399	1.000	1.000	0.000	786	1.000	1.000	Q15399.pdb.gz	TLR1_HUMAN Toll-like receptor 1 OS=Homo sapiens OX=9606 GN=TLR1 PE=1 SV=3
2	AFDB:Q9EPQ1	0.905	0.895	4.076E-101	795	0.737	0.728	Q9EPQ1.pdb.gz	TLR1_MOUSE Toll-like receptor 1 OS=Mus musculus OX=10090 GN=Tlr1 PE=1 SV=1
3	AFDB:E9PTL5	0.901	0.905	2.950E-97	783	0.695	0.697	E9PTL5.pdb.gz	E9PTL5_RAT Toll-like receptor 1 OS=Rattus norvegicus OX=10116 GN=Tlr1 PE=3 SV=3
4	AFDB:Q9Y2C9	0.868	0.858	8.982E-89	796	0.684	0.676	Q9Y2C9.pdb.gz	TLR6_HUMAN Toll-like receptor 6 OS=Homo sapiens OX=9606 GN=TLR6 PE=1 SV=2
5	AFDB:Q9EPW9	0.831	0.823	1.165E-82	795	0.595	0.589	Q9EPW9.pdb.gz	TLR6_MOUSE Toll-like receptor 6 OS=Mus musculus OX=10090 GN=Tlr6 PE=1 SV=2
6	AFDB:G3V695	0.756	0.734	1.665E-80	811	0.588	0.570	G3V695.pdb.gz	G3V695_RAT Toll-like receptor OS=Rattus norvegicus OX=10116 GN=Tlr6 PE=3 SV=2
7	AFDB:F6SU23	0.698	0.672	1.144E-72	818	0.503	0.483	F6SU23.pdb.gz
8	AFDB:Q9BXR5	0.778	0.757	3.853E-70	811	0.492	0.477	Q9BXR5.pdb.gz	TLR10_HUMAN Toll-like receptor 10 OS=Homo sapiens OX=9606 GN=TLR10 PE=1 SV=2
9	AFDB:A5H0S2	0.503	0.604	2.998E-56	652	0.396	0.477	A5H0S2.pdb.gz	A5H0S2_CHICK Toll-like receptor 1-like protein b OS=Gallus gallus OX=9031 GN=TLR1Lb PE=2 SV=1
10	AFDB:E9PTD9	0.599	0.600	1.037E-43	784	0.314	0.315	E9PTD9.pdb.gz	E9PTD9_RAT Toll-like receptor 2 OS=Rattus norvegicus OX=10116 GN=Tlr2 PE=1 SV=1
11	PDB:3j0aA	0.339	0.336	7.975E-24	797	0.200	0.197	3j0aA.pdb.gz	Toll-like receptor 5 forms asymmetric dimers in the absence of flagellin.
12	PDB:7wv3A	0.400	0.451	4.776E-15	668	0.158	0.186	7wv3A.pdb.gz	TLR3 forms a highly organized cluster when bound to a poly(I:C) RNA ligand.
13	PDB:3t6qA	0.412	0.506	3.026E-12	601	0.132	0.173	3t6qA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
14	PDB:6gffI	0.340	0.455	1.924E-11	551	0.144	0.205	6gffI.pdb.gz
15	PDB:7tvfD	0.289	0.403	6.503E-11	515	0.134	0.204	7tvfD.pdb.gz	Structure of the SHOC2-MRAS-PP1C complex provides insights into RAF activation and Noonan syndrome.
16	PDB:3b2dA	0.395	0.484	9.760E-11	601	0.137	0.180	3b2dA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
17	PDB:7wrqA	0.261	0.328	2.503E-7	566	0.123	0.171	7wrqA.pdb.gz
18	PDB:7p5vB	0.321	0.340	4.492E-6	732	0.102	0.109	7p5vB.pdb.gz
19	PDB:6hkwA	0.176	0.336	6.160E-6	306	0.093	0.239	6hkwA.pdb.gz
20	PDB:1a4yA	0.265	0.403	1.662E-5	460	0.081	0.139	1a4yA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A096MKA9	0.0	942	806	0.598	0.583	A0A096MKA9_RAT Toll-like receptor OS=Rattus norvegicus OX=10116 GN=Tlr6 PE=3 SV=2
2	A5H0S2	0.0	633	652	0.398	0.480	A5H0S2_CHICK Toll-like receptor 1-like protein b OS=Gallus gallus OX=9031 GN=TLR1Lb PE=2 SV=1
3	E9PTL5	0.0	1190	808	0.732	0.712	E9PTL5_RAT Toll-like receptor 1 OS=Rattus norvegicus OX=10116 GN=Tlr1 PE=3 SV=3
4	G3V695	0.0	918	811	0.587	0.568	G3V695_RAT Toll-like receptor OS=Rattus norvegicus OX=10116 GN=Tlr6 PE=3 SV=2
5	Q15399	0.0	1608	786	1.000	1.000	TLR1_HUMAN Toll-like receptor 1 OS=Homo sapiens OX=9606 GN=TLR1 PE=1 SV=3
6	Q5WA51	0.0	748	818	0.508	0.488	Q5WA51_CHICK Toll-like receptor 1 OS=Gallus gallus OX=9031 GN=TLR1 PE=2 SV=1
7	Q6P690	0.0	942	806	0.598	0.583	Q6P690_RAT Toll-like receptor OS=Rattus norvegicus OX=10116 GN=Tlr6 PE=2 SV=1
8	Q9BXR5	0.0	742	811	0.499	0.483	TLR10_HUMAN Toll-like receptor 10 OS=Homo sapiens OX=9606 GN=TLR10 PE=1 SV=2
9	Q9EPQ1	0.0	1206	795	0.738	0.730	TLR1_MOUSE Toll-like receptor 1 OS=Mus musculus OX=10090 GN=Tlr1 PE=1 SV=1
10	Q9EPW9	0.0	939	795	0.595	0.589	TLR6_MOUSE Toll-like receptor 6 OS=Mus musculus OX=10090 GN=Tlr6 PE=1 SV=2
11	Q9Y2C9	0.0	1106	796	0.687	0.678	TLR6_HUMAN Toll-like receptor 6 OS=Homo sapiens OX=9606 GN=TLR6 PE=1 SV=2
12	Q9QUN7	2.92e-106	345	784	0.307	0.307	TLR2_MOUSE Toll-like receptor 2 OS=Mus musculus OX=10090 GN=Tlr2 PE=1 SV=1
13	Q6YGU2	2.92e-101	332	784	0.316	0.316	Q6YGU2_RAT Toll-like receptor 2 OS=Rattus norvegicus OX=10116 GN=Tlr2 PE=2 SV=1
14	E9PTD9	3.17e-101	332	784	0.316	0.316	E9PTD9_RAT Toll-like receptor 2 OS=Rattus norvegicus OX=10116 GN=Tlr2 PE=1 SV=1
15	O60603	3.67e-101	332	784	0.289	0.290	TLR2_HUMAN Toll-like receptor 2 OS=Homo sapiens OX=9606 GN=TLR2 PE=1 SV=1
16	Q9DD78	8.40e-96	318	793	0.307	0.304	TLR21_CHICK Toll-like receptor 2 type-1 OS=Gallus gallus OX=9031 GN=TLR2-1 PE=2 SV=1
17	Q6TS42	5.28e-86	291	788	0.309	0.308	Q6TS42_DANRE Toll-like receptor 2 OS=Danio rerio OX=7955 GN=tlr2 PE=2 SV=1
18	F1QWS9	7.68e-86	291	818	0.322	0.309	F1QWS9_DANRE Toll-like receptor 2 OS=Danio rerio OX=7955 GN=tlr2 PE=3 SV=1
19	Q2XQ10	1.52e-62	228	868	0.182	0.165	Q2XQ10_CHICK Toll-like receptor 2 OS=Gallus gallus OX=9031 GN=TLR15 PE=2 SV=1
20	A0A2R8RTN4	2.31e-41	165	955	0.162	0.133	A0A2R8RTN4_DANRE Toll-like receptor 22 OS=Danio rerio OX=7955 GN=TLR21.2 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01463 LRRCT	0.33	22.6	Leucine rich repeat C-terminal domain
2	PF00560 LRR_1	6.4	18.5	Leucine Rich Repeat
3	PF12799 LRR_4	1.4e-14	65.2	Leucine Rich repeats (2 copies)
4	PF13516 LRR_6	0.87	20.9	Leucine Rich repeat
5	PF13855 LRR_8	1.1e-17	74.9	Leucine rich repeat
6	PF14580 LRR_9	0.017	26.2	Leucine-rich repeat
7	PF01361 Tautomerase	5.7e+02	11.8	Tautomerase enzyme
8	PF01582 TIR	7.3e-24	96.0	TIR domain
9	PF13676 TIR_2	1e-14	66.6	TIR domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354932

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000401399	0.999	Myeloid differentiation primary response protein MyD88
2	9606.ENSP00000260010	0.985	Toll-like receptor 2
3	9606.ENSP00000284818	0.979	Lymphocyte antigen 96
4	9606.ENSP00000376445	0.979	Toll/interleukin-1 receptor domain-containing adapter protein
5	9606.ENSP00000358997	0.975	Interleukin-1 receptor-associated kinase 1
6	9606.ENSP00000390651	0.971	Interleukin-1 receptor-associated kinase 4
7	9606.ENSP00000304236	0.969	Monocyte differentiation antigen CD14
8	9606.ENSP00000389600	0.962	Toll-like receptor 6
9	9606.ENSP00000256458	0.956	Interleukin-1 receptor-associated kinase-like 2
10	9606.ENSP00000345347	0.950	High mobility group protein B1
11	9606.ENSP00000373620	0.949	60 kDa heat shock protein, mitochondrial
12	9606.ENSP00000359424	0.941	Inhibitor of nuclear factor kappa-B kinase subunit alpha
13	9606.ENSP00000430684	0.941	Inhibitor of nuclear factor kappa-B kinase subunit beta
14	9606.ENSP00000483825	0.941	NF-kappa-B essential modulator
15	9606.ENSP00000265077	0.915	Versican core protein
16	9606.ENSP00000327336	0.913	Biglycan
17	9606.ENSP00000397082	0.905	Pulmonary surfactant-associated protein A1
18	9606.ENSP00000297185	0.814	Stress-70 protein, mitochondrial
19	9606.ENSP00000433138	0.795	Caspase-1
20	9606.ENSP00000300589	0.791	Nucleotide-binding oligomerization domain-containing protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0038023	1.000	signaling receptor activity
GO:0005102	0.999	signaling receptor binding
GO:0042802	0.998	identical protein binding
GO:0033218	0.963	amide binding
GO:0042277	0.952	peptide binding
GO:0008289	0.937	lipid binding
GO:0004888	0.603	transmembrane signaling receptor activity
GO:0071723	0.539	lipopeptide binding
GO:0035325	0.410	Toll-like receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048583	0.997	regulation of response to stimulus
GO:0048518	0.997	positive regulation of biological process
GO:0002376	0.996	immune system process
GO:0007165	0.996	signal transduction
GO:0009605	0.995	response to external stimulus
GO:0031347	0.991	regulation of defense response
GO:0002684	0.990	positive regulation of immune system process
GO:0042221	0.989	response to chemical
GO:0044419	0.987	biological process involved in interspecies interaction between organisms
GO:0009607	0.987	response to biotic stimulus
GO:0050776	0.985	regulation of immune response
GO:0032103	0.985	positive regulation of response to external stimulus
GO:0031349	0.977	positive regulation of defense response
GO:0002253	0.977	activation of immune response
GO:0045088	0.975	regulation of innate immune response
GO:0045089	0.970	positive regulation of innate immune response
GO:0002221	0.960	pattern recognition receptor signaling pathway
GO:0010033	0.958	response to organic substance
GO:0002237	0.949	response to molecule of bacterial origin
GO:0002224	0.943	toll-like receptor signaling pathway
GO:0048522	0.942	positive regulation of cellular process
GO:0006950	0.918	response to stress
GO:0060255	0.908	regulation of macromolecule metabolic process
GO:0010468	0.890	regulation of gene expression
GO:0051239	0.885	regulation of multicellular organismal process
GO:0001817	0.883	regulation of cytokine production
GO:0009893	0.858	positive regulation of metabolic process
GO:0051606	0.853	detection of stimulus
GO:0098581	0.812	detection of external biotic stimulus
GO:0010647	0.773	positive regulation of cell communication
GO:0023056	0.772	positive regulation of signaling
GO:0009966	0.743	regulation of signal transduction
GO:0010604	0.728	positive regulation of macromolecule metabolic process
GO:0006952	0.696	defense response
GO:0006955	0.679	immune response
GO:0032490	0.623	detection of molecule of bacterial origin
GO:0009967	0.578	positive regulation of signal transduction
GO:0001819	0.562	positive regulation of cytokine production
GO:0032501	0.516	multicellular organismal process
GO:0031323	0.491	regulation of cellular metabolic process
GO:0080090	0.466	regulation of primary metabolic process
GO:0051171	0.459	regulation of nitrogen compound metabolic process
GO:0008152	0.426	metabolic process
GO:0070887	0.408	cellular response to chemical stimulus
GO:0032677	0.386	regulation of interleukin-8 production
GO:0071310	0.383	cellular response to organic substance
GO:0098542	0.358	defense response to other organism
GO:0065009	0.325	regulation of molecular function
GO:0051173	0.316	positive regulation of nitrogen compound metabolic process
GO:0048519	0.312	negative regulation of biological process
GO:0006954	0.311	inflammatory response
GO:0031325	0.306	positive regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0012505	0.998	endomembrane system
GO:0032991	0.989	protein-containing complex
GO:0005737	0.977	cytoplasm
GO:0043227	0.965	membrane-bounded organelle
GO:0043231	0.961	intracellular membrane-bounded organelle
GO:0043235	0.887	receptor complex
GO:0098796	0.740	membrane protein complex
GO:0098797	0.729	plasma membrane protein complex
GO:0098802	0.427	plasma membrane signaling receptor complex
GO:0005794	0.300	Golgi apparatus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]