StarFunc result for job id Q15406

User Input

>input (480 residues)
MERDEPPPSGGGGGGGSAGFLEPPAALPPPPRNGFCQDELAELDPGTISVSDDRAEQRTC
LICGDRATGLHYGIISCEGCKGFFKRSICNKRVYRCSRDKNCVMSRKQRNRCQYCRLLKC
LQMGMNRKAIREDGMPGGRNKSIGPVQISEEEIERIMSGQEFEEEANHWSNHGDSDHSSP
GNRASESNQPSPGSTLSSSRSVELNGFMAFREQYMGMSVPPHYQYIPHLFSYSGHSPLLP
QQARSLDPQSYSLIHQLLSAEDLEPLGTPMLIEDGYAVTQAELFALLCRLADELLFRQIA
WIKKLPFFCELSIKDYTCLLSSTWQELILLSSLTVYSKQIFGELADVTAKYSPSDEELHR
FSDEGMEVIERLIYLYHKFHQLKVSNEEYACMKAINFLNQDIRGLTSASQLEQLNKRYWY
ICQDFTEYKYTHQPNRFPDLMMCLPEIRYIAGKMVNVPLEQLPLLFKVVLHSCKTSVGKE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q64249	0.702	0.683	1.644E-58	495	0.983	0.954	Q64249.pdb.gz	NR6A1_MOUSE Nuclear receptor subfamily 6 group A member 1 OS=Mus musculus OX=10090 GN=Nr6a1 PE=1 SV=1
2	AFDB:P70033	0.621	0.680	3.527E-51	435	0.750	0.828	P70033.pdb.gz	NR6A1_XENLA Nuclear receptor subfamily 6 group A member 1 OS=Xenopus laevis OX=8355 GN=nr6a1 PE=1 SV=2
3	AFDB:F1QJG0	0.348	0.365	9.576E-19	454	0.244	0.258	F1QJG0.pdb.gz	F1QJG0_DANRE Nuclear receptor subfamily 5, group A, member 1a OS=Danio rerio OX=7955 GN=SF1-A PE=3 SV=1
4	AFDB:O00482	0.352	0.315	1.086E-18	541	0.252	0.224	O00482.pdb.gz	NR5A2_HUMAN Nuclear receptor subfamily 5 group A member 2 OS=Homo sapiens OX=9606 GN=NR5A2 PE=1 SV=2
5	AFDB:P45448	0.456	0.399	1.182E-18	560	0.263	0.225	P45448.pdb.gz	NR5A2_MOUSE Nuclear receptor subfamily 5 group A member 2 OS=Mus musculus OX=10090 GN=Nr5a2 PE=1 SV=3
6	AFDB:P33242	0.384	0.396	1.726E-18	462	0.242	0.251	P33242.pdb.gz	STF1_MOUSE Steroidogenic factor 1 OS=Mus musculus OX=10090 GN=Nr5a1 PE=1 SV=3
7	AFDB:B3DKN2	0.353	0.318	6.926E-18	537	0.277	0.248	B3DKN2.pdb.gz	B3DKN2_DANRE Nr5a5 protein OS=Danio rerio OX=7955 GN=fd46g06 PE=2 SV=1
8	AFDB:P10588	0.331	0.385	1.541E-17	404	0.246	0.292	P10588.pdb.gz	NR2F6_HUMAN Nuclear receptor subfamily 2 group F member 6 OS=Homo sapiens OX=9606 GN=NR2F6 PE=1 SV=2
9	AFDB:P10589	0.342	0.382	2.898E-17	423	0.254	0.288	P10589.pdb.gz	COT1_HUMAN COUP transcription factor 1 OS=Homo sapiens OX=9606 GN=NR2F1 PE=1 SV=1
10	AFDB:Q06726	0.336	0.395	5.683E-17	403	0.237	0.283	Q06726.pdb.gz	NR2F5_DANRE Nuclear receptor subfamily 2 group F member 5 OS=Danio rerio OX=7955 GN=nr2f5 PE=2 SV=1
11	PDB:3dzyA	0.316	0.484	2.592E-12	302	0.202	0.321	3dzyA.pdb.gz	Structure of the intact PPAR-gamma-RXR- nuclear receptor complex on DNA.
12	PDB:6fx0A	0.335	0.650	2.084E-6	238	0.077	0.155	6fx0A.pdb.gz	Structure-based design of Trifarotene (CD5789), a potent and selective RAR gamma agonist for the treatment of acne.
13	PDB:1g2nA	0.326	0.613	9.895E-6	246	0.098	0.191	1g2nA.pdb.gz	Crystal structure of the ligand-binding domain of the ultraspiracle protein USP, the ortholog of retinoid X receptors in insects.
14	PDB:4im0A	0.063	0.053	3.683E-1	619	0.087	0.068	4im0A.pdb.gz	Structure and ubiquitination-dependent activation of TANK-binding kinase 1.
15	PDB:5dxhD	0.117	0.071	4.545E-1	981	0.050	0.024	5dxhD.pdb.gz	The Rational Design of Selective Benzoxazepin Inhibitors of the alpha-Isoform of Phosphoinositide 3-Kinase Culminating in the Identification of (S)-2-((2-(1-Isopropyl-1H-1,2,4-triazol-5-yl)-5,6-dihydrobenzo[f]imidazo[1,2-d][1,4]oxazepin-9-yl)oxy)propanamide (GDC-0326).
16	PDB:4yknA	0.106	0.055	5.379E-1	1205	0.052	0.021	4yknA.pdb.gz	Discovery of a Potent Class of PI3K alpha Inhibitors with Unique Binding Mode via Encoded Library Technology (ELT).
17	PDB:4q25A	0.100	0.194	6.103E-1	211	0.044	0.100	4q25A.pdb.gz
18	PDB:6xz6A	0.087	0.161	6.365E-1	213	0.050	0.113	6xz6A.pdb.gz
19	PDB:5itdA	0.120	0.070	7.222E-1	995	0.056	0.027	5itdA.pdb.gz	Discovery and Pharmacological Characterization of Novel Quinazoline-Based PI3K Delta-Selective Inhibitors.
20	PDB:7wq3R	0.102	0.134	7.533E-1	289	0.054	0.090	7wq3R.pdb.gz	Molecular basis for allosteric agonism and G protein subtype selectivity of galanin receptors

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P70033	0.0	753	435	0.750	0.828	NR6A1_XENLA Nuclear receptor subfamily 6 group A member 1 OS=Xenopus laevis OX=8355 GN=nr6a1 PE=1 SV=2
2	Q15406	0.0	999	480	1.000	1.000	NR6A1_HUMAN Nuclear receptor subfamily 6 group A member 1 OS=Homo sapiens OX=9606 GN=NR6A1 PE=1 SV=2
3	Q64249	0.0	973	495	0.983	0.954	NR6A1_MOUSE Nuclear receptor subfamily 6 group A member 1 OS=Mus musculus OX=10090 GN=Nr6a1 PE=1 SV=1
4	F1QJG0	2.12e-46	169	454	0.263	0.278	F1QJG0_DANRE Nuclear receptor subfamily 5, group A, member 1a OS=Danio rerio OX=7955 GN=SF1-A PE=3 SV=1
5	P45448	7.33e-46	169	560	0.260	0.223	NR5A2_MOUSE Nuclear receptor subfamily 5 group A member 2 OS=Mus musculus OX=10090 GN=Nr5a2 PE=1 SV=3
6	Q9QWM1	9.06e-46	169	560	0.260	0.223	NR5A2_RAT Nuclear receptor subfamily 5 group A member 2 OS=Rattus norvegicus OX=10116 GN=Nr5a2 PE=2 SV=1
7	Q9IAI9	2.92e-45	166	454	0.260	0.275	Q9IAI9_DANRE Ff1b OS=Danio rerio OX=7955 GN=ff1b PE=2 SV=1
8	O00482	4.85e-44	164	541	0.263	0.233	NR5A2_HUMAN Nuclear receptor subfamily 5 group A member 2 OS=Homo sapiens OX=9606 GN=NR5A2 PE=1 SV=2
9	Q05192	2.82e-43	165	808	0.258	0.153	FTF1B_DROME Nuclear hormone receptor FTZ-F1 beta OS=Drosophila melanogaster OX=7227 GN=Hr39 PE=1 SV=3
10	P10588	8.77e-38	144	404	0.231	0.275	NR2F6_HUMAN Nuclear receptor subfamily 2 group F member 6 OS=Homo sapiens OX=9606 GN=NR2F6 PE=1 SV=2
11	Q9W539	3.49e-33	136	1518	0.113	0.036	HR4_DROME Hormone receptor 4 OS=Drosophila melanogaster OX=7227 GN=Hr4 PE=1 SV=4
12	Q64104	1.97e-31	126	385	0.219	0.273	NR2E1_MOUSE Nuclear receptor subfamily 2 group E member 1 OS=Mus musculus OX=10090 GN=Nr2e1 PE=1 SV=1
13	Q9Y466	4.11e-31	125	385	0.229	0.286	NR2E1_HUMAN Nuclear receptor subfamily 2 group E member 1 OS=Homo sapiens OX=9606 GN=NR2E1 PE=1 SV=1
14	Q9QXZ7	5.13e-31	125	395	0.215	0.261	NR2E3_MOUSE Photoreceptor-specific nuclear receptor OS=Mus musculus OX=10090 GN=Nr2e3 PE=1 SV=1
15	Q9U2R6	8.67e-31	126	474	0.113	0.114	NHR91_CAEEL Nuclear hormone receptor family member nhr-91 OS=Caenorhabditis elegans OX=6239 GN=nhr-91 PE=1 SV=2
16	H0ZLY1	1.18e-30	127	621	0.252	0.195	H0ZLY1_TAEGU Estrogen receptor OS=Taeniopygia guttata OX=59729 GN=ESR1 PE=3 SV=2
17	W5UDK8	1.14e-29	124	575	0.246	0.205	W5UDK8_ICTPU Estrogen receptor beta OS=Ictalurus punctatus OX=7998 GN=esr2 PE=2 SV=1
18	Q9IAK1	1.21e-29	124	575	0.246	0.205	ESR2_ICTPU Estrogen receptor beta OS=Ictalurus punctatus OX=7998 GN=esr2 PE=2 SV=1
19	Q91250	4.36e-29	122	587	0.252	0.206	ESR1_TAEGU Estrogen receptor OS=Taeniopygia guttata OX=59729 GN=ESR1 PE=2 SV=1
20	P28701	1.04e-26	114	467	0.113	0.116	RXRG_CHICK Retinoic acid receptor RXR-gamma OS=Gallus gallus OX=9031 GN=RXRG PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00104 Hormone_recep	4.5e-15	67.4	Ligand-binding domain of nuclear hormone receptor
2	PF00105 zf-C4	4.7e-25	99.2	Zinc finger, C4 type (two domains)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000420267

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264198	0.941	Mitochondrial ubiquitin ligase activator of NFKB 1
2	9606.ENSP00000296145	0.938	Teratocarcinoma-derived growth factor 1
3	9606.ENSP00000332247	0.902	V-type proton ATPase 116 kDa subunit a isoform 2
4	9606.ENSP00000268712	0.867	Nuclear receptor corepressor 1
5	9606.ENSP00000366434	0.755	BRCA1-A complex subunit RAP80
6	9606.ENSP00000381717	0.731	Ubiquitin-conjugating enzyme E2 D2
7	9606.ENSP00000442336	0.672	DNA topoisomerase 3-alpha
8	9606.ENSP00000328547	0.640	DNA (cytosine-5)-methyltransferase 3B
9	9606.ENSP00000344844	0.638	Hepatitis A virus cellular receptor 1
10	9606.ENSP00000259915	0.634	POU domain, class 5, transcription factor 1
11	9606.ENSP00000256362	0.631	Vertnin
12	9606.ENSP00000384018	0.614	Nuclear receptor corepressor 2
13	9606.ENSP00000229307	0.612	Homeobox protein NANOG
14	9606.ENSP00000325546	0.588	Zinc finger protein PLAG1
15	9606.ENSP00000371661	0.581	Ligand-dependent nuclear receptor corepressor-like protein
16	9606.ENSP00000264709	0.545	DNA (cytosine-5)-methyltransferase 3A
17	9606.ENSP00000368253	0.531	Nuclear receptor subfamily 0 group B member 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0043565	1.000	sequence-specific DNA binding
GO:0003700	0.999	DNA-binding transcription factor activity
GO:0003690	0.997	double-stranded DNA binding
GO:1990837	0.980	sequence-specific double-stranded DNA binding
GO:0000981	0.957	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001067	0.904	transcription regulatory region nucleic acid binding
GO:0000976	0.894	transcription cis-regulatory region binding
GO:0000977	0.801	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000978	0.736	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0038023	0.623	signaling receptor activity
GO:0098531	0.497	ligand-activated transcription factor activity
GO:0042802	0.451	identical protein binding
GO:0004879	0.445	nuclear receptor activity
GO:0001228	0.429	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0008134	0.403	transcription factor binding
GO:0046983	0.302	protein dimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048522	0.987	positive regulation of cellular process
GO:0009893	0.986	positive regulation of metabolic process
GO:0010604	0.978	positive regulation of macromolecule metabolic process
GO:0031325	0.966	positive regulation of cellular metabolic process
GO:0009987	0.965	cellular process
GO:0051173	0.944	positive regulation of nitrogen compound metabolic process
GO:0080090	0.940	regulation of primary metabolic process
GO:0010468	0.937	regulation of gene expression
GO:0032501	0.933	multicellular organismal process
GO:0006355	0.930	regulation of DNA-templated transcription
GO:0045935	0.887	positive regulation of nucleobase-containing compound metabolic process
GO:0006357	0.875	regulation of transcription by RNA polymerase II
GO:0009891	0.866	positive regulation of biosynthetic process
GO:0010557	0.864	positive regulation of macromolecule biosynthetic process
GO:0051254	0.760	positive regulation of RNA metabolic process
GO:0048519	0.721	negative regulation of biological process
GO:0031328	0.713	positive regulation of cellular biosynthetic process
GO:0032502	0.681	developmental process
GO:1902680	0.663	positive regulation of RNA biosynthetic process
GO:0048856	0.600	anatomical structure development
GO:0045893	0.599	positive regulation of DNA-templated transcription
GO:0048523	0.597	negative regulation of cellular process
GO:0050896	0.589	response to stimulus
GO:0009892	0.528	negative regulation of metabolic process
GO:0010605	0.508	negative regulation of macromolecule metabolic process
GO:0009890	0.492	negative regulation of biosynthetic process
GO:0031324	0.480	negative regulation of cellular metabolic process
GO:0051172	0.479	negative regulation of nitrogen compound metabolic process
GO:0010558	0.471	negative regulation of macromolecule biosynthetic process
GO:0031327	0.471	negative regulation of cellular biosynthetic process
GO:0051253	0.451	negative regulation of RNA metabolic process
GO:0051716	0.445	cellular response to stimulus
GO:0045892	0.423	negative regulation of DNA-templated transcription
GO:0045944	0.378	positive regulation of transcription by RNA polymerase II
GO:0007275	0.356	multicellular organism development
GO:0008152	0.349	metabolic process
GO:0000122	0.345	negative regulation of transcription by RNA polymerase II
GO:0071704	0.334	organic substance metabolic process
GO:0044238	0.314	primary metabolic process
GO:0000003	0.312	reproduction
GO:0006807	0.304	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0032991	0.984	protein-containing complex
GO:0005737	0.706	cytoplasm
GO:0005829	0.317	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]