StarFunc result for job id Q15413

User Input

>input (1400 residues)
MAEGGEGGEDEIQFLRTEDEVVLQCIATIHKEQRKFCLAAEGLGNRLCFLEPTSEAKYIP
PDLCVCNFVLEQSLSVRALQEMLANTGENGGEGAAQGGGHRTLLYGHAVLLRHSFSGMYL
TCLTTSRSQTDKLAFDVGLREHATGEACWWTIHPASKQRSEGEKVRIGDDLILVSVSSER
YLHLSVSNGNIQVDASFMQTLWNVHPTCSGSSIEEGYLLGGHVVRLFHGHDECLTIPSTD
QNDSQHRRIFYEAGGAGTRARSLWRVEPLRISWSGSNIRWGQAFRLRHLTTGHYLALTED
QGLILQDRAKSDTKSTAFSFRASKELKEKLDSSHKRDIEGMGVPEIKYGDSVCFVQHIAS
GLWVTYKAQDAKTSRLGPLKRKVILHQEGHMDDGLTLQRCQREESQAARIIRNTTALFSQ
FVSGNNRTAAPITLPIEEVLQTLQDLIAYFQPPEEEMRHEDKQNKLRSLKNRQNLFKEEG
MLALVLNCIDRLNVYNSVAHFAGIAREESGMAWKEILNLLYKLLAALIRGNRNNCAQFSN
NLDWLISKLDRLESSSGILEVLHCILTESPEALNLIAEGHIKSIISLLDKHGRNHKVLDI
LCSLCLCNGVAVRANQNLICDNLLPRRNLLLQTRLINDVTSIRPNIFLGVAEGSAQYKKW
YFELIIDQVDPFLTAEPTHLRVGWASSSGYAPYPGGGEGWGGNGVGDDLYSYGFDGLHLW
SGRIPRAVASINQHLLRSDDVVSCCLDLGVPSISFRINGQPVQGMFENFNTDGLFFPVMS
FSAGVKVRFLMGGRHGEFKFLPPSGYAPCYEALLPKEKMRLEPVKEYKRDADGIRDLLGT
TQFLSQASFIPCPVDTSQVILPPHLEKIRDRLAENIHELWGMNKIELGWTFGKIRDDNKR
QHPCLVEFSKLPETEKNYNLQMSTETLKTLLALGCHIAHVNPAAEEDLKKVKLPKNYMMS
NGYKPAPLDLSDVKLLPPQEILVDKLAENAHNVWAKDRIKQGWTYGIQQDLKNKRNPRLV
PYALLDERTKKSNRDSLREAVRTFVGYGYNIEPSDQELADSAVEKVSIDKIRFFRVERSY
AVRSGKWYFEFEVVTGGDMRVGWARPGCRPDVELGADDQAFVFEGNRGQRWHQGSGYFGR
TWQPGDVVGCMINLDDASMIFTLNGELLITNKGSELAFADYEIENGFVPICCLGLSQIGR
MNLGTDASTFKFYTMCGLQEGFEPFAVNMNRDVAMWFSKRLPTFVNVPKDHPHIEVMRID
GTMDSPPCLKVTHKTFGTQNSNADMIYCRLSMPVECHSSFSHSPCLDSEAFQKRKQMQEI
LSHTTTQCYYAIRIFAGQDPSCVWVGWVTPDYHLYSEKFDLNKNCTVTVTLGDERGRVHE
SVKRSNCYMVWGGDIVASSQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:3j8hA	0.817	0.320	0.000	3660	0.608	0.233	3j8hA.pdb.gz	Structure of the rabbit ryanodine receptor RyR1 at near-atomic resolution.
2	PDB:5gkyA	0.822	0.321	0.000	3660	0.608	0.233	5gkyA.pdb.gz	The Central domain of RyR1 is the transducer for long-range allosteric gating of channel opening
3	PDB:5t15B	0.842	0.288	0.000	4170	0.620	0.208	5t15B.pdb.gz	Structural Basis for Gating and Activation of RyR1.
4	PDB:6wotA	0.853	0.292	0.000	4197	0.641	0.214	6wotA.pdb.gz	Structural mechanism of two gain-of-function cardiac and skeletal RyR mutations at an equivalent site by cryo-EM.
5	PDB:6wouA	0.862	0.319	0.000	3921	0.656	0.234	6wouA.pdb.gz	Structural mechanism of two gain-of-function cardiac and skeletal RyR mutations at an equivalent site by cryo-EM.
6	PDB:7cf9A	0.889	0.320	0.000	3949	0.654	0.232	7cf9A.pdb.gz	Structural basis for diamide modulation of ryanodine receptor.
7	PDB:7m6aA	0.930	0.307	0.000	4306	0.676	0.220	7m6aA.pdb.gz	High-resolution structure of the membrane-embedded skeletal muscle ryanodine receptor.
8	PDB:7t65A	0.870	0.295	0.000	4252	0.659	0.217	7t65A.pdb.gz	Molecular mechanism of the severe MH/CCD mutation Y522S in skeletal ryanodine receptor (RyR1) by cryo-EM.
9	PDB:7tdgA	0.826	0.287	0.000	4134	0.621	0.210	7tdgA.pdb.gz	Ca 2+ -inactivation of the mammalian ryanodine receptor type 1 in a lipidic environment revealed by cryo-EM.
10	PDB:7tzcA	0.934	0.302	0.000	4404	0.678	0.215	7tzcA.pdb.gz	A drug and ATP binding site in type 1 ryanodine receptor.
11	AFDB:Q14573	0.340	0.189	1.340E-26	2671	0.096	0.050	Q14573.pdb.gz	ITPR3_HUMAN Inositol 1,4,5-trisphosphate receptor type 3 OS=Homo sapiens OX=9606 GN=ITPR3 PE=1 SV=2
12	AFDB:A0A0R4IH08	0.335	0.188	5.641E-26	2634	0.091	0.048	A0A0R4IH08.pdb.gz	A0A0R4IH08_DANRE Inositol 1,4,5-trisphosphate receptor OS=Danio rerio OX=7955 GN=si:dkey-163f12.8 PE=3 SV=2
13	AFDB:P18160	0.093	0.055	2.062E-9	2410	0.064	0.037	P18160.pdb.gz	SPLA_DICDI Dual specificity protein kinase splA OS=Dictyostelium discoideum OX=44689 GN=splA PE=1 SV=3
14	AFDB:A3RJH1	0.096	0.176	2.252E-7	740	0.028	0.053	A3RJH1.pdb.gz	A3RJH1_HUMAN ATP-dependent RNA helicase OS=Homo sapiens OX=9606 GN=DDX1 PE=2 SV=1
15	AFDB:Q19614	0.095	0.296	3.295E-7	433	0.028	0.090	Q19614.pdb.gz	TOFU2_CAEEL Protein tofu-2 OS=Caenorhabditis elegans OX=6239 GN=tofu-2 PE=2 SV=3
16	AFDB:Q9VNV3	0.099	0.183	4.430E-7	727	0.032	0.062	Q9VNV3.pdb.gz	DDX1_DROME ATP-dependent RNA helicase Ddx1 OS=Drosophila melanogaster OX=7227 GN=Ddx1 PE=2 SV=1
17	AFDB:Q9SIZ8	0.092	0.101	5.473E-7	1280	0.029	0.031	Q9SIZ8.pdb.gz	RKP_ARATH E3 ubiquitin-protein ligase RKP OS=Arabidopsis thaliana OX=3702 GN=RKP PE=2 SV=2
18	AFDB:Q9VFC4	0.093	0.097	5.710E-7	1332	0.029	0.030	Q9VFC4.pdb.gz	Q9VFC4_DROME RING-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=Kpc1 PE=1 SV=1
19	AFDB:E1JGL8	0.085	0.093	1.172E-6	1272	0.036	0.039	E1JGL8.pdb.gz	E1JGL8_DROME Uncharacterized protein, isoform C OS=Drosophila melanogaster OX=7227 GN=Dmel\CG30122 PE=1 SV=1
20	AFDB:Q5XPI4	0.095	0.101	1.510E-6	1314	0.031	0.033	Q5XPI4.pdb.gz	RN123_HUMAN E3 ubiquitin-protein ligase RNF123 OS=Homo sapiens OX=9606 GN=RNF123 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A060WZC7	0.0	1537	4791	0.514	0.150	A0A060WZC7_ONCMY Skeletal muscle ryanodine receptor OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00004066001 PE=4 SV=1
2	A2AGL3	0.0	2895	4863	0.970	0.279	RYR3_MOUSE Ryanodine receptor 3 OS=Mus musculus OX=10090 GN=Ryr3 PE=1 SV=1
3	A6P4B8	0.0	1924	5076	0.650	0.179	A6P4B8_DANRE Ryanodine receptor 1 OS=Danio rerio OX=7955 GN=si:dkey-250i19.1 PE=1 SV=1
4	B0LPN4	0.0	1979	4953	0.657	0.186	RYR2_RAT Ryanodine receptor 2 OS=Rattus norvegicus OX=10116 GN=Ryr2 PE=1 SV=2
5	B7WN66	0.0	1213	5085	0.435	0.120	B7WN66_CAEEL Ryanodine receptor 44F OS=Caenorhabditis elegans OX=6239 GN=unc-68 PE=1 SV=5
6	E9PZQ0	0.0	1883	5035	0.647	0.180	RYR1_MOUSE Ryanodine receptor 1 OS=Mus musculus OX=10090 GN=Ryr1 PE=1 SV=1
7	E9Q401	0.0	1975	4966	0.657	0.185	RYR2_MOUSE Ryanodine receptor 2 OS=Mus musculus OX=10090 GN=Ryr2 PE=1 SV=1
8	F1LMY4	0.0	1868	5035	0.644	0.179	RYR1_RAT Ryanodine receptor 1 OS=Rattus norvegicus OX=10116 GN=Ryr1 PE=1 SV=1
9	G1U7D3	0.0	1519	4598	0.542	0.165	G1U7D3_RABIT Ryanodine receptor 1 OS=Oryctolagus cuniculus OX=9986 GN=RYR1 PE=4 SV=2
10	I2HAA6	0.0	1214	5187	0.435	0.117	I2HAA6_CAEEL Ryanodine receptor 44F OS=Caenorhabditis elegans OX=6239 GN=unc-68 PE=1 SV=2
11	I2HAA7	0.0	1213	5071	0.435	0.120	I2HAA7_CAEEL Ryanodine receptor 44F OS=Caenorhabditis elegans OX=6239 GN=unc-68 PE=1 SV=2
12	P11716	0.0	1900	5037	0.653	0.181	RYR1_RABIT Ryanodine receptor 1 OS=Oryctolagus cuniculus OX=9986 GN=RYR1 PE=1 SV=1
13	P21817	0.0	1893	5038	0.647	0.180	RYR1_HUMAN Ryanodine receptor 1 OS=Homo sapiens OX=9606 GN=RYR1 PE=1 SV=3
14	P30957	0.0	1980	4969	0.657	0.185	RYR2_RABIT Ryanodine receptor 2 OS=Oryctolagus cuniculus OX=9986 GN=RYR2 PE=1 SV=3
15	Q15413	0.0	2957	4870	1.000	0.287	RYR3_HUMAN Ryanodine receptor 3 OS=Homo sapiens OX=9606 GN=RYR3 PE=1 SV=3
16	Q24498	0.0	1286	5127	0.475	0.130	RYR_DROME Ryanodine receptor OS=Drosophila melanogaster OX=7227 GN=RyR PE=1 SV=3
17	Q92736	0.0	1980	4967	0.657	0.185	RYR2_HUMAN Ryanodine receptor 2 OS=Homo sapiens OX=9606 GN=RYR2 PE=1 SV=3
18	Q94279	0.0	1213	5201	0.435	0.117	Q94279_CAEEL Ryanodine receptor 44F OS=Caenorhabditis elegans OX=6239 GN=unc-68 PE=1 SV=6
19	Q9TS33	0.0	2746	4872	0.952	0.274	RYR3_RABIT Ryanodine receptor 3 OS=Oryctolagus cuniculus OX=9986 GN=RYR3 PE=1 SV=1
20	P29995	1.19e-25	118	2701	0.104	0.054	ITPR2_RAT Inositol 1,4,5-trisphosphate receptor type 2 OS=Rattus norvegicus OX=10116 GN=Itpr2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08709 Ins145_P3_rec	1.8e-59	212.0	Inositol 1,4,5-trisphosphate/ryanodine receptor
2	PF02815 MIR	5.2e-58	207.5	MIR domain
3	PF01365 RYDR_ITPR	6.7e-66	233.2	RIH domain
4	PF02026 RyR	9.1e-64	223.1	RyR domain
5	PF00622 SPRY	5e-46	167.1	SPRY domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000373884

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355533	0.979	Ryanodine receptor 2
2	9606.ENSP00000383003	0.962	Peptidyl-prolyl cis-trans isomerase FKBP1A
3	9606.ENSP00000272298	0.947	Calmodulin 2 (phosphorylase kinase, delta)
4	9606.ENSP00000352608	0.941	Ryanodine receptor 1
5	9606.ENSP00000370373	0.930	Peptidyl-prolyl cis-trans isomerase FKBP1B
6	9606.ENSP00000439281	0.930	Triadin
7	9606.ENSP00000355747	0.897	Presenilin-2
8	9606.ENSP00000368767	0.897	Aspartyl/asparaginyl beta-hydroxylase
9	9606.ENSP00000349467	0.890	Calmodulin-1
10	9606.ENSP00000291295	0.876	Calmodulin 3 (phosphorylase kinase, delta)
11	9606.ENSP00000326366	0.876	Presenilin-1
12	9606.ENSP00000477999	0.836	Nitric oxide synthase, brain
13	9606.ENSP00000226279	0.809	ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1
14	9606.ENSP00000357057	0.795	Calsequestrin-1
15	9606.ENSP00000266376	0.775	Voltage-dependent L-type calcium channel subunit alpha-1C
16	9606.ENSP00000349595	0.760	Sarcoplasmic/endoplasmic reticulum calcium ATPase 1
17	9606.ENSP00000353072	0.759	Sarcoplasmic/endoplasmic reticulum calcium ATPase 3
18	9606.ENSP00000292169	0.750	Protein S100-A1
19	9606.ENSP00000261448	0.747	Calsequestrin-2
20	9606.ENSP00000440045	0.736	Sarcoplasmic/endoplasmic reticulum calcium ATPase 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0015278	0.999	calcium-release channel activity
GO:0005219	0.988	ryanodine-sensitive calcium-release channel activity
GO:0042802	0.864	identical protein binding
GO:0043167	0.812	ion binding
GO:0043168	0.736	anion binding
GO:0097159	0.701	organic cyclic compound binding
GO:0005516	0.509	calmodulin binding
GO:0036094	0.439	small molecule binding
GO:0019899	0.429	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.885	biological regulation
GO:0009987	0.880	cellular process
GO:0050789	0.871	regulation of biological process
GO:0003012	0.869	muscle system process
GO:0050896	0.846	response to stimulus
GO:0098771	0.828	inorganic ion homeostasis
GO:0006811	0.827	monoatomic ion transport
GO:0050794	0.808	regulation of cellular process
GO:0055074	0.770	calcium ion homeostasis
GO:0006936	0.723	muscle contraction
GO:0006874	0.716	intracellular calcium ion homeostasis
GO:0051716	0.677	cellular response to stimulus
GO:0006816	0.658	calcium ion transport
GO:0006941	0.657	striated muscle contraction
GO:0007224	0.615	smoothened signaling pathway
GO:0003009	0.602	skeletal muscle contraction
GO:0010243	0.576	response to organonitrogen compound
GO:0055085	0.523	transmembrane transport
GO:0043279	0.491	response to alkaloid
GO:0014074	0.490	response to purine-containing compound
GO:0098660	0.479	inorganic ion transmembrane transport
GO:0098662	0.448	inorganic cation transmembrane transport
GO:0070588	0.343	calcium ion transmembrane transport
GO:0070887	0.325	cellular response to chemical stimulus
GO:0071310	0.312	cellular response to organic substance

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016529	1.000	sarcoplasmic reticulum
GO:0016020	0.999	membrane
GO:0098827	0.995	endoplasmic reticulum subcompartment
GO:0031090	0.994	organelle membrane
GO:0042175	0.988	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0005789	0.979	endoplasmic reticulum membrane
GO:0098588	0.977	bounding membrane of organelle
GO:0033017	0.963	sarcoplasmic reticulum membrane
GO:0032991	0.850	protein-containing complex
GO:0034704	0.380	calcium channel complex
GO:0005886	0.301	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29671	0.999	Ca(2+)(in) = Ca(2+)(out)

[back to server]