StarFunc result for job id Q15415

User Input

>input (496 residues)
MVEADHPGKLFIGGLNRETNEKMLKAVFGKHGPISEVLLIKDRTSKSRGFAFITFENPAD
AKNAAKDMNGTSLHGKAIKVEQAKKPSFQSGGRRRPPASSRNRSPSGSLRSARGSSGGTR
GWLPSHEGHLDDGGYTPDLKMSYSRGLIPVKRGPSSRSGGPPPKKSAPSAVARSNSWMGS
QGPMSQRRENYGVPPRRATISSWRNDRMSTRHDGYATNDGNHPSCQETRDYAPPSRGYAY
RDNGHSNRDEHSSRGYRNHRSSRETRDYAPPSRGHAYRDYGHSRRDESYSRGYRNHRSSR
ETREYAPPSRGHGYRDYGHSRRHESYSRGYRNHPSSRETRDYAPPHRDYAYRDYGHSSWD
EHSSRGYSYHDGYGEALGRDHSEHLSGSSYRDALQRYGTSHGAPPARGPRMSYGGSTCHA
YSNTRDRYGRSWESYSSCGDFHYCDREHVCRKDQRNPPSLGRVLPDPREAYGSSSYVASI
VDGGESRSEKGDSSRY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A6NDE4	0.557	0.557	6.201E-64	496	0.992	0.992	A6NDE4.pdb.gz	RBY1B_HUMAN RNA-binding motif protein, Y chromosome, family 1 member B OS=Homo sapiens OX=9606 GN=RBMY1B PE=2 SV=2
2	AFDB:J3KPK3	0.217	0.233	4.378E-57	459	0.913	0.987	J3KPK3.pdb.gz	J3KPK3_HUMAN RNA binding motif protein Y-linked family 1 member E OS=Homo sapiens OX=9606 GN=RBMY1E PE=4 SV=1
3	AFDB:P38159	0.189	0.237	9.855E-28	391	0.474	0.601	P38159.pdb.gz	RBMX_HUMAN RNA-binding motif protein, X chromosome OS=Homo sapiens OX=9606 GN=RBMX PE=1 SV=3
4	AFDB:O35698	0.180	0.233	1.054E-18	380	0.312	0.408	O35698.pdb.gz	RBY1A_MOUSE RNA-binding motif protein, Y chromosome, family 1 member A1 OS=Mus musculus OX=10090 GN=Rbmy1a1 PE=1 SV=2
5	PDB:5yzg1	0.154	0.312	1.984E-9	243	0.065	0.132	5yzg1.pdb.gz	Structure of a human catalytic step I spliceosome
6	PDB:7dvqY	0.156	0.541	3.320E-9	140	0.050	0.179	7dvqY.pdb.gz	Structure of the activated human minor spliceosome.
7	AFDB:E9PYH6	0.166	0.052	6.014E-9	1716	0.185	0.054	E9PYH6.pdb.gz	SET1A_MOUSE Histone-lysine N-methyltransferase SETD1A OS=Mus musculus OX=10090 GN=Setd1a PE=1 SV=1
8	AFDB:Q9UPS6	0.167	0.046	6.414E-9	1966	0.212	0.053	Q9UPS6.pdb.gz	SET1B_HUMAN Histone-lysine N-methyltransferase SETD1B OS=Homo sapiens OX=9606 GN=SETD1B PE=1 SV=3
9	AFDB:Q1LY77	0.168	0.051	6.840E-9	1844	0.208	0.056	Q1LY77.pdb.gz	SE1BA_DANRE Histone-lysine N-methyltransferase SETD1B-A OS=Danio rerio OX=7955 GN=setd1ba PE=1 SV=2
10	PDB:6y53o	0.155	0.471	8.175E-9	160	0.054	0.169	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
11	PDB:6qx91K	0.164	0.394	1.283E-8	201	0.056	0.139	6qx91K.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
12	AFDB:F4JYK6	0.173	0.189	1.481E-8	453	0.171	0.188	F4JYK6.pdb.gz	F4JYK6_ARATH RNA-binding (RRM/RBD/RNP motifs) family protein OS=Arabidopsis thaliana OX=3702 GN=MNJ7.21 PE=1 SV=1
13	PDB:5gm6V	0.156	0.576	2.777E-8	128	0.058	0.227	5gm6V.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
14	AFDB:A0A0S2Z4Z0	0.140	0.104	3.006E-8	669	0.175	0.130	A0A0S2Z4Z0.pdb.gz	A0A0S2Z4Z0_HUMAN RNA binding motif protein 14 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=RBM14 PE=2 SV=1
15	AFDB:Q8CFT2	0.169	0.047	3.419E-8	1985	0.190	0.047	Q8CFT2.pdb.gz	SET1B_MOUSE Histone-lysine N-methyltransferase SETD1B OS=Mus musculus OX=10090 GN=Setd1b PE=1 SV=2
16	PDB:3lqvB	0.155	0.634	4.648E-8	115	0.040	0.174	3lqvB.pdb.gz	Branch Recognition by SF3b14
17	PDB:6g90B	0.162	0.407	1.481E-7	193	0.054	0.140	6g90B.pdb.gz	Prespliceosome structure provides insights into spliceosome assembly and regulation.
18	PDB:6n7pA	0.157	0.411	1.915E-7	186	0.052	0.140	6n7pA.pdb.gz	A unified mechanism for intron and exon definition and back-splicing.
19	PDB:5xjcw	0.151	0.800	2.043E-7	91	0.044	0.242	5xjcw.pdb.gz	An Atomic Structure of the Human Spliceosome
20	PDB:6ff7X	0.149	0.410	3.888E-7	171	0.040	0.117	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6NDE4	0.0	982	496	0.992	0.992	RBY1B_HUMAN RNA-binding motif protein, Y chromosome, family 1 member B OS=Homo sapiens OX=9606 GN=RBMY1B PE=2 SV=2
2	A6NEQ0	0.0	978	496	0.988	0.988	RBY1E_HUMAN RNA-binding motif protein, Y chromosome, family 1 member E OS=Homo sapiens OX=9606 GN=RBMY1E PE=1 SV=1
3	J3KPK3	0.0	886	459	0.913	0.987	J3KPK3_HUMAN RNA binding motif protein Y-linked family 1 member E OS=Homo sapiens OX=9606 GN=RBMY1E PE=4 SV=1
4	J3KQ82	0.0	899	459	0.925	1.000	J3KQ82_HUMAN RNA binding motif protein Y-linked family 1 member F OS=Homo sapiens OX=9606 GN=RBMY1F PE=4 SV=1
5	P0C7P1	0.0	978	496	0.990	0.990	RBY1D_HUMAN RNA-binding motif protein, Y chromosome, family 1 member D OS=Homo sapiens OX=9606 GN=RBMY1D PE=2 SV=1
6	P0DJD3	0.0	980	496	0.992	0.992	RBY1A_HUMAN RNA-binding motif protein, Y chromosome, family 1 member A1 OS=Homo sapiens OX=9606 GN=RBMY1A1 PE=1 SV=1
7	P0DJD4	0.0	978	496	0.990	0.990	RBY1C_HUMAN RNA-binding motif protein, Y chromosome, family 1 member C OS=Homo sapiens OX=9606 GN=RBMY1C PE=1 SV=1
8	Q15415	0.0	991	496	1.000	1.000	RBY1F_HUMAN RNA-binding motif protein, Y chromosome, family 1 member F/J OS=Homo sapiens OX=9606 GN=RBMY1F PE=1 SV=2
9	Q91VM5	1.19e-80	258	388	0.343	0.438	RMXL1_MOUSE RNA binding motif protein, X-linked-like-1 OS=Mus musculus OX=10090 GN=Rbmxl1 PE=2 SV=1
10	P84586	1.80e-79	254	388	0.339	0.433	RMXRL_RAT RNA-binding motif protein, X chromosome retrogene-like OS=Rattus norvegicus OX=10116 GN=Rbmxrtl PE=1 SV=1
11	Q4V898	2.10e-79	254	390	0.333	0.423	RBMX_RAT RNA-binding motif protein, X chromosome OS=Rattus norvegicus OX=10116 GN=Rbmx PE=1 SV=1
12	P38159	3.82e-77	249	391	0.333	0.422	RBMX_HUMAN RNA-binding motif protein, X chromosome OS=Homo sapiens OX=9606 GN=RBMX PE=1 SV=3
13	O35698	8.83e-52	182	380	0.250	0.326	RBY1A_MOUSE RNA-binding motif protein, Y chromosome, family 1 member A1 OS=Mus musculus OX=10090 GN=Rbmy1a1 PE=1 SV=2
14	K7EPM4	6.86e-26	105	168	0.097	0.286	K7EPM4_HUMAN Cold-inducible RNA-binding protein OS=Homo sapiens OX=9606 GN=CIRBP PE=1 SV=1
15	Q9DED4	8.94e-26	105	166	0.097	0.289	CIRBB_XENLA Cold-inducible RNA-binding protein B OS=Xenopus laevis OX=8355 GN=cirbp-b PE=1 SV=1
16	P60824	9.23e-26	105	172	0.097	0.279	CIRBP_MOUSE Cold-inducible RNA-binding protein OS=Mus musculus OX=10090 GN=Cirbp PE=1 SV=1
17	P60825	9.23e-26	105	172	0.097	0.279	CIRBP_RAT Cold-inducible RNA-binding protein OS=Rattus norvegicus OX=10116 GN=Cirbp PE=2 SV=1
18	Q14011	9.89e-26	105	172	0.097	0.279	CIRBP_HUMAN Cold-inducible RNA-binding protein OS=Homo sapiens OX=9606 GN=CIRBP PE=1 SV=1
19	Q53XX5	9.89e-26	105	172	0.097	0.279	Q53XX5_HUMAN Cold-inducible RNA-binding protein OS=Homo sapiens OX=9606 GN=CIRBP PE=2 SV=1
20	K7EMY9	1.01e-25	105	159	0.097	0.302	K7EMY9_HUMAN Cold-inducible RNA-binding protein OS=Homo sapiens OX=9606 GN=CIRBP PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08081 RBM1CTR	1.1e-18	78.2	RBM1CTR (NUC064) family
2	PF00076 RRM_1	6.2e-18	75.7	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
3	PF13893 RRM_5	9.2	17.4	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
4	PF16367 RRM_7	1.9e+02	13.6	RNA recognition motif
5	PF16842 RRM_occluded	1.3e+02	13.8	Occluded RNA-recognition motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000060317

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000048388	0.800	Uncharacterized protein
2	9598.ENSPTRP00000048393	0.800	Uncharacterized protein
3	9598.ENSPTRP00000060371	0.800	Uncharacterized protein
4	9598.ENSPTRP00000027026	0.743	Transformer 2 beta homolog
5	9598.ENSPTRP00000048426	0.739	Uncharacterized protein
6	9598.ENSPTRP00000060395	0.738	Pan troglodytes chromodomain protein, Y-linked, 1 (CDY1), mRNA
7	9598.ENSPTRP00000046641	0.733	Heterogeneous nuclear ribonucleoprotein C (C1/C2)
8	9598.ENSPTRP00000042216	0.730	Polypyrimidine tract binding protein 1
9	9598.ENSPTRP00000017736	0.717	Heterogeneous nuclear ribonucleoprotein M
10	9598.ENSPTRP00000000569	0.703	Heterogeneous nuclear ribonucleoprotein R
11	9598.ENSPTRP00000032472	0.687	Heterogeneous nuclear ribonucleoprotein A2/B1
12	9598.ENSPTRP00000018758	0.671	Heterogeneous nuclear ribonucleoprotein L
13	9598.ENSPTRP00000016036	0.638	Pan troglodytes serine/arginine-rich splicing factor 1 (SRSF1), mRNA
14	9598.ENSPTRP00000048014	0.636	Heterogeneous nuclear ribonucleoprotein A0
15	9598.ENSPTRP00000050686	0.618	Pan troglodytes heterogeneous nuclear ribonucleoprotein F (HNRNPF), mRNA
16	9598.ENSPTRP00000048403	0.557	Uncharacterized protein
17	9598.ENSPTRP00000037628	0.556	Uncharacterized protein
18	9598.ENSPTRP00000027859	0.552	Uncharacterized protein
19	9598.ENSPTRP00000038035	0.547	Pan troglodytes heterogeneous nuclear ribonucleoprotein H2 (H') (HNRNPH2), mRNA
20	9598.ENSPTRP00000003693	0.546	Heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A)

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003723	1.000	RNA binding
GO:0042802	0.998	identical protein binding
GO:0003729	0.992	mRNA binding
GO:0003677	0.813	DNA binding
GO:0043565	0.583	sequence-specific DNA binding
GO:0003690	0.370	double-stranded DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0043484	0.979	regulation of RNA splicing
GO:1903311	0.688	regulation of mRNA metabolic process
GO:0050684	0.411	regulation of mRNA processing
GO:0048024	0.367	regulation of mRNA splicing, via spliceosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0043232	0.998	intracellular non-membrane-bounded organelle
GO:0005730	0.981	nucleolus
GO:0032991	0.929	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]