StarFunc result for job id Q15431

User Input

>input (976 residues)
MEKQKPFALFVPPRSSSSQVSAVKPQTLGGDSTFFKSFNKCTEDDFEFPFAKTNLSKNGE
NIDSDPALQKVNFLPVLEQVGNSDCHYQEGLKDSDLENSEGLSRVYSKLYKEAEKIKKWK
VSTEAELRQKESKLQENRKIIEAQRKAIQELQFGNEKVSLKLEEGIQENKDLIKENNATR
HLCNLLKETCARSAEKTKKYEYEREETRQVYMDLNNNIEKMITAFEELRVQAENSRLEMH
FKLKEDYEKIQHLEQEYKKEINDKEKQVSLLLIQITEKENKMKDLTFLLEESRDKVNQLE
EKTKLQSENLKQSIEKQHHLTKELEDIKVSLQRSVSTQKALEEDLQIATKTICQLTEEKE
TQMEESNKARAAHSFVVTEFETTVCSLEELLRTEQQRLEKNEDQLKILTMELQKKSSELE
EMTKLTNNKEVELEELKKVLGEKETLLYENKQFEKIAEELKGTEQELIGLLQAREKEVHD
LEIQLTAITTSEQYYSKEVKDLKTELENEKLKNTELTSHCNKLSLENKELTQETSDMTLE
LKNQQEDINNNKKQEERMLKQIENLQETETQLRNELEYVREELKQKRDEVKCKLDKSEEN
CNNLRKQVENKNKYIEELQQENKALKKKGTAESKQLNVYEIKVNKLELELESAKQKFGEI
TDTYQKEIEDKKISEENLLEEVEKAKVIADEAVKLQKEIDKRCQHKIAEMVALMEKHKHQ
YDKIIEERDSELGLYKSKEQEQSSLRASLEIELSNLKAELLSVKKQLEIEREEKEKLKRE
AKENTATLKEKKDKKTQTFLLETPEIYWKLDSKAVPSQTVSRNFTSVDHGISKDKRDYLW
TSAKNTLSTPLPKAYTVKTPTKPKLQQRENLNIPIEESKKKRKMAFEFDINSDSSETTDL
LSMVSEEETLKTLYRNNNPPASHLCVKTPKKAPSSLTTPGSTLKFGAIRKMREDRWAVIA
KMDRKKKLKEAEKLFV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15431	1.000	1.000	0.000	976	1.000	1.000	Q15431.pdb.gz	SYCP1_HUMAN Synaptonemal complex protein 1 OS=Homo sapiens OX=9606 GN=SYCP1 PE=1 SV=2
2	AFDB:Q03410	0.196	0.192	7.368E-82	997	0.749	0.733	Q03410.pdb.gz	SYCP1_RAT Synaptonemal complex protein 1 OS=Rattus norvegicus OX=10116 GN=Sycp1 PE=1 SV=2
3	AFDB:Q0JJ05	0.189	0.187	5.147E-3	987	0.164	0.162	Q0JJ05.pdb.gz	NMCPB_ORYSJ Nuclear matrix constituent protein 1b OS=Oryza sativa subsp. japonica OX=39947 GN=NMCP1B PE=1 SV=1
4	AFDB:A4GSN8	0.102	0.059	5.558E-3	2093	0.175	0.082	A4GSN8.pdb.gz	NUA_ARATH Nuclear-pore anchor OS=Arabidopsis thaliana OX=3702 GN=NUA PE=1 SV=1
5	AFDB:B2RXW8	0.090	0.075	1.199E-2	1241	0.130	0.102	B2RXW8.pdb.gz	B2RXW8_MOUSE Ppfia1 protein OS=Mus musculus OX=10090 GN=Ppfia1 PE=1 SV=1
6	AFDB:E9KL37	0.100	0.097	1.631E-2	1012	0.117	0.113	E9KL37.pdb.gz	E9KL37_HUMAN Epididymis tissue sperm binding protein Li 5a OS=Homo sapiens OX=9606 GN=OFD1 PE=2 SV=1
7	AFDB:Q5SNZ0	0.093	0.052	1.631E-2	1873	0.191	0.099	Q5SNZ0.pdb.gz	GRDN_MOUSE Girdin OS=Mus musculus OX=10090 GN=Ccdc88a PE=1 SV=2
8	AFDB:E9Q7G0	0.101	0.054	1.761E-2	2094	0.175	0.082	E9Q7G0.pdb.gz	NUMA1_MOUSE Nuclear mitotic apparatus protein 1 OS=Mus musculus OX=10090 GN=Numa1 PE=1 SV=1
9	AFDB:Q02455	0.131	0.072	1.761E-2	1875	0.181	0.094	Q02455.pdb.gz	MLP1_YEAST Protein MLP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MLP1 PE=1 SV=2
10	AFDB:F6ZDS4	0.099	0.044	2.396E-2	2431	0.194	0.078	F6ZDS4.pdb.gz	TPR_MOUSE Nucleoprotein TPR OS=Mus musculus OX=10090 GN=Tpr PE=1 SV=1
11	PDB:6yxyAE	0.023	0.045	9.349	434	0.011	0.025	6yxyAE.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q03410	0.0	1361	997	0.740	0.724	SYCP1_RAT Synaptonemal complex protein 1 OS=Rattus norvegicus OX=10116 GN=Sycp1 PE=1 SV=2
2	Q15431	0.0	1940	976	1.000	1.000	SYCP1_HUMAN Synaptonemal complex protein 1 OS=Homo sapiens OX=9606 GN=SYCP1 PE=1 SV=2
3	Q62209	0.0	1310	993	0.735	0.722	SYCP1_MOUSE Synaptonemal complex protein 1 OS=Mus musculus OX=10090 GN=Sycp1 PE=1 SV=2
4	P24043	4.72e-07	56.6	3122	0.118	0.037	LAMA2_HUMAN Laminin subunit alpha-2 OS=Homo sapiens OX=9606 GN=LAMA2 PE=1 SV=4
5	Q6IQX1	0.024	41.2	1935	0.136	0.069	Q6IQX1_DANRE Myosin, heavy polypeptide 2, fast muscle specific isoform X1 OS=Danio rerio OX=7955 GN=sb:cb38 PE=1 SV=1
6	A0A2R8Y590	0.075	39.7	2122	0.033	0.015	A0A2R8Y590_HUMAN A-kinase anchoring protein 9 OS=Homo sapiens OX=9606 GN=AKAP9 PE=1 SV=2
7	Q86W92	0.075	39.3	1011	0.043	0.042	LIPB1_HUMAN Liprin-beta-1 OS=Homo sapiens OX=9606 GN=PPFIBP1 PE=1 SV=2
8	A0A0G2K1V4	0.088	39.3	1937	0.117	0.059	A0A0G2K1V4_RAT Myosin heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Myh1 PE=1 SV=2
9	Q5SX40	0.090	39.3	1942	0.117	0.059	MYH1_MOUSE Myosin-1 OS=Mus musculus OX=10090 GN=Myh1 PE=1 SV=1
10	F1LRV9	0.092	39.3	1943	0.117	0.059	F1LRV9_RAT Myosin heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Myh1 PE=1 SV=3
11	A0A0A0MRF6	0.10	39.3	3931	0.033	0.008	A0A0A0MRF6_HUMAN A-kinase anchoring protein 9 OS=Homo sapiens OX=9606 GN=AKAP9 PE=1 SV=2
12	Q99996	0.11	38.9	3907	0.033	0.008	AKAP9_HUMAN A-kinase anchor protein 9 OS=Homo sapiens OX=9606 GN=AKAP9 PE=1 SV=4
13	Q960T6	0.26	37.7	1059	0.028	0.025	Q960T6_DROME Centrosomal protein 135kDa, isoform A OS=Drosophila melanogaster OX=7227 GN=Cep135 PE=1 SV=1
14	M9MSL4	0.27	37.7	1065	0.028	0.025	M9MSL4_DROME Centrosomal protein 135kDa, isoform B OS=Drosophila melanogaster OX=7227 GN=Cep135 PE=4 SV=1
15	M9PCK8	0.28	37.7	960	0.028	0.028	M9PCK8_DROME Centrosomal protein 135kDa, isoform C OS=Drosophila melanogaster OX=7227 GN=Cep135 PE=4 SV=1
16	Q4U0S2	0.28	37.7	1974	0.106	0.052	Q4U0S2_DANRE Myosin-11 OS=Danio rerio OX=7955 GN=myh11 PE=1 SV=1
17	Q10411	0.50	37.0	1957	0.080	0.040	SPO15_SCHPO Sporulation-specific protein 15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=spo15 PE=1 SV=1
18	P12882	0.73	36.2	1939	0.116	0.058	MYH1_HUMAN Myosin-1 OS=Homo sapiens OX=9606 GN=MYH1 PE=1 SV=3
19	Q9UKX2	0.74	36.2	1941	0.125	0.063	MYH2_HUMAN Myosin-2 OS=Homo sapiens OX=9606 GN=MYH2 PE=1 SV=1
20	A0A0R4IVY5	0.79	36.2	1359	0.119	0.085	A0A0R4IVY5_DANRE Rho-associated protein kinase OS=Danio rerio OX=7955 GN=rock1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05483 SCP-1	0	1537.7	Synaptonemal complex protein 1 (SCP-1)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000358535

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000341282	0.994	Synaptonemal complex central element protein 1
2	9606.ENSP00000350162	0.983	Synaptonemal complex protein 2
3	9606.ENSP00000293695	0.981	Synaptonemal complex central element protein 2
4	9606.ENSP00000376658	0.980	Synaptonemal complex protein 3
5	9606.ENSP00000280358	0.931	Testis-expressed protein 12
6	9606.ENSP00000385480	0.931	Synaptonemal complex central element protein 3
7	9606.ENSP00000482546	0.925	Meiotic recombination protein REC8 homolog
8	9606.ENSP00000477973	0.913	Cohesin subunit SA-3
9	9606.ENSP00000386414	0.899	Double-strand-break repair protein rad21-like protein 1
10	9606.ENSP00000350036	0.883	Structural maintenance of chromosomes protein 1B
11	9606.ENSP00000297338	0.842	Double-strand-break repair protein rad21 homolog
12	9606.ENSP00000360310	0.821	Meiotic recombination protein SPO11
13	9606.ENSP00000355167	0.810	HORMA domain-containing protein 1
14	9606.ENSP00000354720	0.793	Structural maintenance of chromosomes protein 3
15	9606.ENSP00000263187	0.791	MutS protein homolog 4
16	9606.ENSP00000252037	0.768	Inactive peptidyl-prolyl cis-trans isomerase FKBP6
17	9606.ENSP00000379226	0.753	Testis-expressed protein 11
18	9606.ENSP00000323421	0.751	Structural maintenance of chromosomes protein 1A
19	9606.ENSP00000275764	0.728	Stimulated by retinoic acid gene 8 protein homolog
20	9606.ENSP00000216024	0.723	Meiotic recombination protein DMC1/LIM15 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003690	0.998	double-stranded DNA binding
GO:0005515	0.744	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0022414	0.989	reproductive process
GO:0022402	0.988	cell cycle process
GO:0007127	0.982	meiosis I
GO:0071704	0.980	organic substance metabolic process
GO:0006259	0.969	DNA metabolic process
GO:0048232	0.967	male gamete generation
GO:0006310	0.964	DNA recombination
GO:0007131	0.946	reciprocal meiotic recombination
GO:0022607	0.929	cellular component assembly
GO:0007283	0.928	spermatogenesis
GO:0051262	0.618	protein tetramerization
GO:0051260	0.603	protein homooligomerization
GO:0065007	0.587	biological regulation
GO:0051289	0.577	protein homotetramerization
GO:0050789	0.538	regulation of biological process
GO:0050794	0.458	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000795	0.999	synaptonemal complex
GO:0005654	0.998	nucleoplasm
GO:0005737	0.727	cytoplasm
GO:0000802	0.520	transverse filament
GO:0005829	0.413	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]