StarFunc result for job id Q15435

User Input

>input (360 residues)
MAAERGAGQQQSQEMMEVDRRVESEESGDEEGKKHSSGIVADLSEQSLKDGEERGEEDPE
EEHELPVDMETINLDRDAEDVDLNHYRIGKIEGFEVLKKVKTLCLRQNLIKCIENLEELQ
SLRELDLYDNQIKKIENLEALTELEILDISFNLLRNIEGVDKLTRLKKLFLVNNKISKIE
NLSNLHQLQMLELGSNRIRAIENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSN
RLTKIEGLQNLVNLRELYLSHNGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTELQE
FWMNDNLLESWSDLDELKGARSLETVYLERNPLQKDPQYRRKVMLALPSVRQIDATFVRF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3UM45	0.832	0.829	8.198E-54	361	0.942	0.939	Q3UM45.pdb.gz	PP1R7_MOUSE Protein phosphatase 1 regulatory subunit 7 OS=Mus musculus OX=10090 GN=Ppp1r7 PE=1 SV=2
2	PDB:6hkwA	0.816	0.957	7.789E-43	306	0.850	1.000	6hkwA.pdb.gz
3	AFDB:Q9U3W5	0.810	0.894	9.947E-34	326	0.447	0.494	Q9U3W5.pdb.gz	Q9U3W5_DROME Putative mitotic protein phosphatase 1 regulator OS=Drosophila melanogaster OX=7227 GN=sds22 PE=2 SV=1
4	AFDB:P45969	0.801	0.883	4.426E-29	326	0.403	0.445	P45969.pdb.gz	SDS22_CAEEL Protein phosphatase 1 regulatory subunit SDS22 homolog OS=Caenorhabditis elegans OX=6239 GN=sds-22 PE=3 SV=1
5	AFDB:P22194	0.778	0.842	3.014E-28	332	0.397	0.431	P22194.pdb.gz	SDS22_SCHPO Protein phosphatase 1 regulatory subunit SDS22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sds22 PE=1 SV=2
6	AFDB:Q5AHH6	0.801	0.772	6.760E-28	374	0.433	0.417	Q5AHH6.pdb.gz	Q5AHH6_CANAL Type 1 protein phosphatase-activating protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SDS22 PE=4 SV=1
7	AFDB:P36047	0.799	0.850	2.923E-27	338	0.428	0.456	P36047.pdb.gz	SDS22_YEAST Protein phosphatase 1 regulatory subunit SDS22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SDS22 PE=1 SV=1
8	AFDB:C6S3E1	0.780	0.906	1.053E-25	309	0.344	0.401	C6S3E1.pdb.gz	C6S3E1_PLAF7 Protein phosphatase 1 regulatory subunit 7 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1032800 PE=3 SV=1
9	AFDB:Q84WJ9	0.779	0.853	1.513E-22	328	0.317	0.348	Q84WJ9.pdb.gz	PP1R7_ARATH Protein phosphatase 1 regulatory inhibitor subunit PPP1R7 homolog OS=Arabidopsis thaliana OX=3702 GN=At5g19680 PE=1 SV=1
10	AFDB:Q8KC98	0.675	0.226	5.230E-18	1102	0.244	0.080	Q8KC98.pdb.gz	Q8KC98_CHLTE Rab family protein OS=Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) OX=194439 GN=CT1526 PE=1 SV=1
11	AFDB:Q96M69	0.585	0.271	6.019E-16	825	0.244	0.107	Q96M69.pdb.gz	LRGUK_HUMAN Leucine-rich repeat and guanylate kinase domain-containing protein OS=Homo sapiens OX=9606 GN=LRGUK PE=1 SV=1
12	PDB:7tvfD	0.494	0.354	2.947E-13	515	0.214	0.150	7tvfD.pdb.gz	Structure of the SHOC2-MRAS-PP1C complex provides insights into RAF activation and Noonan syndrome.
13	PDB:1xcdA	0.621	0.723	9.791E-11	305	0.206	0.243	1xcdA.pdb.gz
14	PDB:7p5vB	0.511	0.264	3.638E-10	732	0.150	0.074	7p5vB.pdb.gz
15	PDB:6gffI	0.554	0.374	1.655E-9	551	0.183	0.120	6gffI.pdb.gz
16	PDB:2ft3F	0.495	0.573	3.190E-9	305	0.181	0.213	2ft3F.pdb.gz
17	PDB:5yq5B	0.615	0.717	4.318E-9	306	0.167	0.196	5yq5B.pdb.gz
18	PDB:1m9sA	0.439	0.306	1.247E-8	523	0.144	0.099	1m9sA.pdb.gz
19	PDB:5xjxC	0.468	0.463	6.271E-8	365	0.178	0.175	5xjxC.pdb.gz
20	PDB:7wrqA	0.521	0.346	1.337E-7	566	0.186	0.118	7wrqA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q15435	0.0	714	360	1.000	1.000	PP1R7_HUMAN Protein phosphatase 1 regulatory subunit 7 OS=Homo sapiens OX=9606 GN=PPP1R7 PE=1 SV=1
2	Q3UM45	0.0	639	361	0.942	0.939	PP1R7_MOUSE Protein phosphatase 1 regulatory subunit 7 OS=Mus musculus OX=10090 GN=Ppp1r7 PE=1 SV=2
3	Q9U3W5	1.26e-94	286	326	0.436	0.482	Q9U3W5_DROME Putative mitotic protein phosphatase 1 regulator OS=Drosophila melanogaster OX=7227 GN=sds22 PE=2 SV=1
4	Q9VEK8	1.49e-94	286	326	0.436	0.482	Q9VEK8_DROME GH07711p OS=Drosophila melanogaster OX=7227 GN=sds22 PE=1 SV=1
5	P45969	5.17e-81	252	326	0.400	0.442	SDS22_CAEEL Protein phosphatase 1 regulatory subunit SDS22 homolog OS=Caenorhabditis elegans OX=6239 GN=sds-22 PE=3 SV=1
6	Q5AHH6	2.04e-79	249	374	0.403	0.388	Q5AHH6_CANAL Type 1 protein phosphatase-activating protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SDS22 PE=4 SV=1
7	P22194	1.47e-75	238	332	0.381	0.413	SDS22_SCHPO Protein phosphatase 1 regulatory subunit SDS22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sds22 PE=1 SV=2
8	P36047	2.03e-66	215	338	0.425	0.453	SDS22_YEAST Protein phosphatase 1 regulatory subunit SDS22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SDS22 PE=1 SV=1
9	Q84WJ9	2.13e-59	196	328	0.331	0.363	PP1R7_ARATH Protein phosphatase 1 regulatory inhibitor subunit PPP1R7 homolog OS=Arabidopsis thaliana OX=3702 GN=At5g19680 PE=1 SV=1
10	C6S3E1	6.79e-57	189	309	0.347	0.405	C6S3E1_PLAF7 Protein phosphatase 1 regulatory subunit 7 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1032800 PE=3 SV=1
11	Q57VV4	1.97e-49	172	403	0.339	0.303	Q57VV4_TRYB2 Protein phosphatase 1, regulatory subunit, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.29K2.820 PE=4 SV=1
12	Q8KC98	5.65e-27	114	1102	0.244	0.080	Q8KC98_CHLTE Rab family protein OS=Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) OX=194439 GN=CT1526 PE=1 SV=1
13	P0DJM0	6.07e-26	111	800	0.233	0.105	INLA_LISMO Internalin A OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) OX=169963 GN=inlA PE=1 SV=1
14	Q91YK0	2.65e-24	106	686	0.181	0.095	LRC49_MOUSE Leucine-rich repeat-containing protein 49 OS=Mus musculus OX=10090 GN=Lrrc49 PE=1 SV=1
15	Q8IUZ0	2.86e-23	103	686	0.175	0.092	LRC49_HUMAN Leucine-rich repeat-containing protein 49 OS=Homo sapiens OX=9606 GN=LRRC49 PE=1 SV=2
16	Q6P1C6	9.61e-21	96.3	1117	0.267	0.086	LRIG3_MOUSE Leucine-rich repeats and immunoglobulin-like domains protein 3 OS=Mus musculus OX=10090 GN=Lrig3 PE=1 SV=1
17	A8IVX2	2.87e-17	85.1	524	0.147	0.101	DRC3_CHLRE Dynein regulatory complex subunit 3 OS=Chlamydomonas reinhardtii OX=3055 GN=DRC3 PE=1 SV=1
18	A0A140VJN4	7.52e-17	84.3	725	0.175	0.087	A0A140VJN4_HUMAN Dynein axonemal assembly factor 1 OS=Homo sapiens OX=9606 PE=2 SV=1
19	Q8NEP3	7.52e-17	84.3	725	0.175	0.087	DAAF1_HUMAN Dynein axonemal assembly factor 1 OS=Homo sapiens OX=9606 GN=DNAAF1 PE=1 SV=5
20	Q9D5S7	7.61e-17	84.3	820	0.194	0.085	LRGUK_MOUSE Leucine-rich repeat and guanylate kinase domain-containing protein OS=Mus musculus OX=10090 GN=Lrguk PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00560 LRR_1	5.1e+02	12.7	Leucine Rich Repeat
2	PF12799 LRR_4	5.7e-38	139.4	Leucine Rich repeats (2 copies)
3	PF13516 LRR_6	1.6	20.0	Leucine Rich repeat
4	PF13855 LRR_8	4.5e-19	79.3	Leucine rich repeat
5	PF14580 LRR_9	1.2e-22	91.8	Leucine-rich repeat
6	PF14814 UB2H	1.2e+02	14.1	Bifunctional transglycosylase second domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000234038

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000341779	0.998	Serine/threonine-protein phosphatase PP1-gamma catalytic subunit
2	9606.ENSP00000326031	0.994	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit
3	9606.ENSP00000378769	0.994	Serine/threonine-protein phosphatase PP1-beta catalytic subunit
4	9606.ENSP00000365963	0.991	Protein phosphatase 1 regulatory subunit 11
5	9606.ENSP00000484580	0.940	Protein phosphatase inhibitor 2
6	9606.ENSP00000351475	0.923	PAS domain-containing serine/threonine-protein kinase
7	9606.ENSP00000313950	0.842	Aurora kinase B
8	9606.ENSP00000351777	0.815	Transitional endoplasmic reticulum ATPase
9	9606.ENSP00000311677	0.793	Nuclear inhibitor of protein phosphatase 1
10	9606.ENSP00000357858	0.792	Mitotic checkpoint protein BUB3
11	9606.ENSP00000328228	0.774	Cell division cycle-associated protein 2
12	9606.ENSP00000365694	0.758	Serine/threonine-protein phosphatase 1 regulatory subunit 10
13	9606.ENSP00000356853	0.750	Uridine-cytidine kinase 2
14	9606.ENSP00000382507	0.736	UBX domain-containing protein 2B
15	9606.ENSP00000265807	0.734	SH2 domain-containing protein 4A
16	9606.ENSP00000315351	0.732	D-2-hydroxyglutarate dehydrogenase, mitochondrial
17	9606.ENSP00000377668	0.732	Sulfite oxidase, mitochondrial
18	9606.ENSP00000313953	0.730	Tetratricopeptide repeat domain containing
19	9606.ENSP00000418529	0.717	NSFL1 cofactor p47
20	9606.ENSP00000335463	0.714	Kinetochore scaffold 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0098772	0.873	molecular function regulator activity
GO:0030234	0.854	enzyme regulator activity
GO:0019208	0.580	phosphatase regulator activity
GO:0019888	0.545	protein phosphatase regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.989	regulation of cellular process
GO:0009987	0.988	cellular process
GO:0048518	0.909	positive regulation of biological process
GO:0019222	0.893	regulation of metabolic process
GO:0060255	0.864	regulation of macromolecule metabolic process
GO:0080090	0.851	regulation of primary metabolic process
GO:0048522	0.819	positive regulation of cellular process
GO:0051171	0.818	regulation of nitrogen compound metabolic process
GO:0031323	0.814	regulation of cellular metabolic process
GO:0019220	0.788	regulation of phosphate metabolic process
GO:0051246	0.774	regulation of protein metabolic process
GO:0009893	0.747	positive regulation of metabolic process
GO:0031325	0.704	positive regulation of cellular metabolic process
GO:0031399	0.679	regulation of protein modification process
GO:0035303	0.646	regulation of dephosphorylation
GO:0035304	0.539	regulation of protein dephosphorylation
GO:0035306	0.479	positive regulation of dephosphorylation
GO:0051173	0.461	positive regulation of nitrogen compound metabolic process
GO:0010604	0.457	positive regulation of macromolecule metabolic process
GO:0007049	0.448	cell cycle
GO:0048519	0.326	negative regulation of biological process
GO:0048523	0.317	negative regulation of cellular process
GO:0051247	0.317	positive regulation of protein metabolic process
GO:0022402	0.315	cell cycle process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0005634	0.985	nucleus
GO:0043232	0.966	intracellular non-membrane-bounded organelle
GO:0005829	0.937	cytosol
GO:0005576	0.923	extracellular region
GO:0070013	0.920	intracellular organelle lumen
GO:0031982	0.894	vesicle
GO:0031981	0.877	nuclear lumen
GO:0005694	0.851	chromosome
GO:0065010	0.797	extracellular membrane-bounded organelle
GO:1903561	0.771	extracellular vesicle
GO:0005615	0.743	extracellular space
GO:0070062	0.706	extracellular exosome
GO:0005654	0.462	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]