StarFunc result for job id Q15464

User Input

>input (509 residues)
MAKWLNKYFSLGNSKTKSPPQPPRPDYREQRRRGERPSQPPQAVPQASSAASASCGPATA
SCFSASSGSLPDDSGSTSDLIRAYRAQKERDFEDPYNGPGSSLRKLRAMCRLDYCGGSGE
PGGVQRAFSASSASGAAGCCCASSGAGAAASSSSSSGSPHLYRSSSERRPATPAEVRYIS
PKHRLIKVESAAGGGAGDPLGGACAGGRTWSPTACGGKKLLNKCAASAAEESGAGKKDKV
TIADDYSDPFDAKNDLKSKAGKGESAGYMEPYEAQRIMTEFQRQESVRSQHKGIQLYDTP
YEPEGQSVDSDSESTVSPRLRESKLPQDDDRPADEYDQPWEWNRVTIPALAAQFNGNEKR
QSSPSPSRDRRRQLRAPGGGFKPIKHGSPEFCGILGERVDPAVPLEKQIWYHGAISRGDA
ENLLRLCKECSYLVRNSQTSKHDYSLSLRSNQGFMHMKLAKTKEKYVLGQNSPPFDSVPE
VIHYYTTRKLPIKGAEHLSLLYPVAVRTL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15464	1.000	1.000	1.630E-85	509	1.000	1.000	Q15464.pdb.gz	SHB_HUMAN SH2 domain-containing adapter protein B OS=Homo sapiens OX=9606 GN=SHB PE=1 SV=2
2	AFDB:Q9JLY0	0.188	0.179	1.396E-8	533	0.173	0.165	Q9JLY0.pdb.gz	SOCS6_MOUSE Suppressor of cytokine signaling 6 OS=Mus musculus OX=10090 GN=Socs6 PE=1 SV=2
3	PDB:1ka6A	0.179	0.760	9.823E-8	107	0.047	0.224	1ka6A.pdb.gz	A "three-pronged" binding mechanism for the SAP/SH2D1A SH2 domain: structural basis and relevance to the XLP syndrome.
4	PDB:4gwfA	0.171	0.175	1.453E-7	497	0.061	0.062	4gwfA.pdb.gz
5	PDB:8dcxB	0.192	0.402	1.767E-7	236	0.071	0.153	8dcxB.pdb.gz
6	PDB:1griA	0.180	0.411	2.613E-7	211	0.045	0.109	1griA.pdb.gz
7	PDB:4fl2A	0.183	0.168	3.392E-7	555	0.047	0.043	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
8	PDB:1k9aB	0.174	0.200	4.403E-7	441	0.049	0.057	1k9aB.pdb.gz
9	PDB:5xzrA	0.183	0.179	5.016E-7	519	0.059	0.058	5xzrA.pdb.gz	Allosteric Inhibitors of SHP2 with Therapeutic Potential for Cancer Treatment.
10	AFDB:Q86P82	0.178	0.145	6.989E-7	634	0.181	0.145	Q86P82.pdb.gz	Q86P82_DROME SD04308p OS=Drosophila melanogaster OX=7227 GN=Socs36E PE=2 SV=1
11	PDB:3ps5A	0.166	0.160	9.022E-7	529	0.051	0.049	3ps5A.pdb.gz	Crystal structure of human protein tyrosine phosphatase SHP-1 in the open conformation.
12	PDB:2h8hA	0.180	0.204	1.097E-6	445	0.061	0.070	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
13	AFDB:Q9HBL0	0.165	0.052	3.344E-6	1735	0.212	0.062	Q9HBL0.pdb.gz	TENS1_HUMAN Tensin-1 OS=Homo sapiens OX=9606 GN=TNS1 PE=1 SV=3
14	PDB:4k2rA	0.186	0.173	4.044E-6	551	0.043	0.040	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
15	AFDB:Q5SSZ5	0.170	0.062	4.945E-6	1440	0.179	0.063	Q5SSZ5.pdb.gz	TENS3_MOUSE Tensin-3 OS=Mus musculus OX=10090 GN=Tns3 PE=1 SV=1
16	AFDB:Q68CZ2	0.156	0.059	1.499E-5	1445	0.161	0.057	Q68CZ2.pdb.gz	TENS3_HUMAN Tensin-3 OS=Homo sapiens OX=9606 GN=TNS3 PE=1 SV=2
17	AFDB:Q04205	0.162	0.051	1.823E-5	1744	0.155	0.045	Q04205.pdb.gz	TENS1_CHICK Tensin-1 OS=Gallus gallus OX=9031 GN=TNS1 PE=1 SV=3
18	AFDB:P00522	0.180	0.060	1.752E-3	1620	0.143	0.045	P00522.pdb.gz	ABL_DROME Tyrosine-protein kinase Abl OS=Drosophila melanogaster OX=7227 GN=Abl PE=1 SV=3
19	AFDB:Q9USL4	0.075	0.072	6.049E-3	549	0.130	0.120	Q9USL4.pdb.gz	NUP61_SCHPO Nucleoporin nup61 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nup61 PE=1 SV=2
20	AFDB:Q6Q7I9	0.055	0.040	1.323E-2	748	0.126	0.086	Q6Q7I9.pdb.gz	Q6Q7I9_DROME Thisbe OS=Drosophila melanogaster OX=7227 GN=ths PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q15464	0.0	1040	509	1.000	1.000	SHB_HUMAN SH2 domain-containing adapter protein B OS=Homo sapiens OX=9606 GN=SHB PE=1 SV=2
2	Q6PD21	0.0	826	503	0.906	0.917	SHB_MOUSE SH2 domain-containing adapter protein B OS=Mus musculus OX=10090 GN=Shb PE=1 SV=2
3	Q96IW2	1.44e-70	230	340	0.283	0.424	SHD_HUMAN SH2 domain-containing adapter protein D OS=Homo sapiens OX=9606 GN=SHD PE=1 SV=1
4	Q5VZ18	1.85e-66	224	495	0.248	0.255	SHE_HUMAN SH2 domain-containing adapter protein E OS=Homo sapiens OX=9606 GN=SHE PE=1 SV=1
5	Q8N9I8	2.72e-18	85.9	212	0.143	0.344	Q8N9I8_HUMAN SHF protein OS=Homo sapiens OX=9606 GN=SHF PE=1 SV=1
6	P00522	7.14e-09	61.2	1620	0.073	0.023	ABL_DROME Tyrosine-protein kinase Abl OS=Drosophila melanogaster OX=7227 GN=Abl PE=1 SV=3
7	Q4JIM5	9.07e-09	60.8	1182	0.061	0.026	ABL2_MOUSE Tyrosine-protein kinase ABL2 OS=Mus musculus OX=10090 GN=Abl2 PE=1 SV=1
8	P42684	1.69e-08	59.7	1182	0.061	0.026	ABL2_HUMAN Tyrosine-protein kinase ABL2 OS=Homo sapiens OX=9606 GN=ABL2 PE=1 SV=1
9	Q95PW9	3.60e-08	57.8	395	0.067	0.086	Q95PW9_CAEEL NCK (Non-Catalytic region of tyrosine Kinase) adaptor protein family OS=Caenorhabditis elegans OX=6239 GN=nck-1 PE=1 SV=2
10	Q95PX0	3.92e-08	57.8	397	0.067	0.086	Q95PX0_CAEEL NCK (Non-Catalytic region of tyrosine Kinase) adaptor protein family OS=Caenorhabditis elegans OX=6239 GN=nck-1 PE=1 SV=2
11	Q2PYT4	6.53e-08	57.8	1143	0.057	0.025	Q2PYT4_RAT Tyrosine-protein kinase (Fragment) OS=Rattus norvegicus OX=10116 PE=2 SV=1
12	E9PT20	6.65e-08	57.8	1143	0.057	0.025	E9PT20_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Abl1 PE=3 SV=1
13	P00520	8.35e-08	57.4	1123	0.057	0.026	ABL1_MOUSE Tyrosine-protein kinase ABL1 OS=Mus musculus OX=10090 GN=Abl1 PE=1 SV=3
14	Q08012	8.36e-08	55.1	211	0.057	0.137	GRAP_DROME Growth factor receptor-bound protein 2 OS=Drosophila melanogaster OX=7227 GN=drk PE=1 SV=1
15	P00519	8.58e-08	57.4	1130	0.057	0.026	ABL1_HUMAN Tyrosine-protein kinase ABL1 OS=Homo sapiens OX=9606 GN=ABL1 PE=1 SV=4
16	P03949	3.07e-07	55.8	1224	0.053	0.022	ABL1_CAEEL Tyrosine-protein kinase abl-1 OS=Caenorhabditis elegans OX=6239 GN=abl-1 PE=1 SV=4
17	E9PYG6	3.45e-07	55.5	1038	0.059	0.029	E9PYG6_MOUSE RAS p21 protein activator 1 OS=Mus musculus OX=10090 GN=Rasa1 PE=1 SV=1
18	P20936	3.87e-07	55.5	1047	0.059	0.029	RASA1_HUMAN Ras GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=RASA1 PE=1 SV=1
19	P50904	3.93e-07	55.5	1038	0.059	0.029	RASA1_RAT Ras GTPase-activating protein 1 OS=Rattus norvegicus OX=10116 GN=Rasa1 PE=1 SV=1
20	F1R3X3	3.97e-07	55.5	1010	0.063	0.032	F1R3X3_DANRE RAS p21 protein activator (GTPase-activating protein) 1a OS=Danio rerio OX=7955 GN=rasa1a PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00017 SH2	1.6e-13	61.9	SH2 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000366936

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263923	0.989	Vascular endothelial growth factor receptor 2
2	9606.ENSP00000362680	0.971	Proto-oncogene tyrosine-protein kinase Src
3	9606.ENSP00000472929	0.970	Proto-oncogene vav
4	9606.ENSP00000265171	0.969	Pro-epidermal growth factor
5	9606.ENSP00000478570	0.928	Vascular endothelial growth factor A
6	9606.ENSP00000257290	0.927	Platelet-derived growth factor receptor alpha
7	9606.ENSP00000360916	0.908	Guanine nucleotide exchange factor VAV2
8	9606.ENSP00000380638	0.905	Protein-tyrosine kinase 2-beta
9	9606.ENSP00000261023	0.902	Integrin alpha-V
10	9606.ENSP00000348461	0.902	Ras-related C3 botulinum toxin substrate 1
11	9606.ENSP00000400175	0.901	Transforming protein RhoA
12	9606.ENSP00000317985	0.900	Rho-associated protein kinase 2
13	9606.ENSP00000359073	0.900	Guanine nucleotide exchange factor VAV3
14	9606.ENSP00000382697	0.900	Rho-associated protein kinase 1
15	9606.ENSP00000452786	0.900	Integrin beta-3
16	9606.ENSP00000300574	0.887	Adapter molecule crk
17	9606.ENSP00000341189	0.874	Focal adhesion kinase 1
18	9606.ENSP00000376345	0.807	Growth factor receptor-bound protein 2
19	9606.ENSP00000393312	0.789	Fibroblast growth factor receptor 1
20	9606.ENSP00000344674	0.769	Dehydrogenase/reductase SDR family member 2, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0001784	0.998	phosphotyrosine residue binding
GO:0060090	0.834	molecular adaptor activity
GO:0035591	0.754	signaling adaptor activity
GO:0030159	0.722	signaling receptor complex adaptor activity
GO:0003824	0.405	catalytic activity
GO:0005102	0.369	signaling receptor binding
GO:0019899	0.301	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.998	response to stimulus
GO:0050794	0.998	regulation of cellular process
GO:0023052	0.995	signaling
GO:0007154	0.995	cell communication
GO:0007165	0.988	signal transduction
GO:0048518	0.849	positive regulation of biological process
GO:0048522	0.839	positive regulation of cellular process
GO:0048583	0.820	regulation of response to stimulus
GO:0007166	0.804	cell surface receptor signaling pathway
GO:0048584	0.610	positive regulation of response to stimulus
GO:0051239	0.608	regulation of multicellular organismal process
GO:0032501	0.597	multicellular organismal process
GO:0019222	0.575	regulation of metabolic process
GO:0031323	0.560	regulation of cellular metabolic process
GO:0080090	0.556	regulation of primary metabolic process
GO:0048519	0.547	negative regulation of biological process
GO:0065009	0.533	regulation of molecular function
GO:0060255	0.504	regulation of macromolecule metabolic process
GO:0048856	0.499	anatomical structure development
GO:0051171	0.498	regulation of nitrogen compound metabolic process
GO:0048523	0.467	negative regulation of cellular process
GO:0045785	0.467	positive regulation of cell adhesion
GO:0050790	0.415	regulation of catalytic activity
GO:0002684	0.400	positive regulation of immune system process
GO:0050793	0.396	regulation of developmental process
GO:0002376	0.389	immune system process
GO:0007169	0.380	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0042325	0.356	regulation of phosphorylation
GO:0001932	0.354	regulation of protein phosphorylation
GO:0009966	0.339	regulation of signal transduction
GO:0031325	0.312	positive regulation of cellular metabolic process
GO:0043549	0.306	regulation of kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005654	0.995	nucleoplasm
GO:0043232	0.987	intracellular non-membrane-bounded organelle
GO:0071944	0.951	cell periphery
GO:0005886	0.916	plasma membrane
GO:0035770	0.867	ribonucleoprotein granule
GO:0036464	0.808	cytoplasmic ribonucleoprotein granule

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]