StarFunc result for job id Q15465

User Input

>input (462 residues)
MLLLARCLLLVLVSSLLVCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASG
RYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGV
KLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAH
IHCSVKAENSVAAKSGGCFPGSATVHLEQGGTKLVKDLSPGDRVLAADDQGRLLYSDFLT
FLDRDDGAKKVFYVIETREPRERLLLTAAHLLFVAPHNDSATGEPEASSGSGPPSGGALG
PRALFASRVRPGQRVYVVAERDGDRRLLPAAVHSVTLSEEAAGAYAPLTAQGTILINRVL
ASCYAVIEEHSWAHRAFAPFRLAHALLAALAPARTDRGGDSGGGDRGGGGGRVALTAPGA
ADAPGAGATAGIHWYSQLLYQIGTWLLDSEALHPLGMAVKSS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15465	1.000	1.000	1.150E-90	462	1.000	1.000	Q15465.pdb.gz	SHH_HUMAN Sonic hedgehog protein OS=Homo sapiens OX=9606 GN=SHH PE=1 SV=1
2	AFDB:Q62226	0.752	0.791	1.051E-74	437	0.866	0.915	Q62226.pdb.gz	SHH_MOUSE Sonic hedgehog protein OS=Mus musculus OX=10090 GN=Shh PE=1 SV=2
3	AFDB:F1P3J4	0.767	0.830	1.191E-68	425	0.766	0.833	F1P3J4.pdb.gz
4	AFDB:Q92008	0.707	0.775	9.277E-62	418	0.647	0.715	Q92008.pdb.gz	SHH_DANRE Sonic hedgehog protein OS=Danio rerio OX=7955 GN=shha PE=1 SV=1
5	AFDB:Q90419	0.615	0.671	1.306E-60	416	0.623	0.692	Q90419.pdb.gz	TWHH_DANRE Tiggy-winkle hedgehog protein OS=Danio rerio OX=7955 GN=shhb PE=1 SV=1
6	AFDB:Q98938	0.627	0.695	2.959E-56	408	0.580	0.657	Q98938.pdb.gz	IHH_CHICK Indian hedgehog protein OS=Gallus gallus OX=9031 GN=IHH PE=2 SV=1
7	AFDB:F1LP42	0.713	0.791	2.681E-55	411	0.567	0.637	F1LP42.pdb.gz	F1LP42_RAT Hedgehog protein OS=Rattus norvegicus OX=10116 GN=Ihh PE=3 SV=2
8	AFDB:Q98862	0.751	0.837	2.833E-55	412	0.545	0.612	Q98862.pdb.gz	IHH_DANRE Indian hedgehog B protein OS=Danio rerio OX=7955 GN=ihhb PE=2 SV=1
9	AFDB:A3KNS3	0.631	0.695	6.842E-55	413	0.558	0.625	A3KNS3.pdb.gz	A3KNS3_DANRE Hedgehog protein OS=Danio rerio OX=7955 GN=hha PE=2 SV=1
10	AFDB:G3V7Y0	0.429	0.494	3.238E-53	396	0.511	0.596	G3V7Y0.pdb.gz	G3V7Y0_RAT Hedgehog protein OS=Rattus norvegicus OX=10116 GN=Dhh PE=3 SV=1
11	PDB:6td6B	0.297	0.964	9.350E-18	140	0.210	0.693	6td6B.pdb.gz
12	PDB:6rpqA	0.259	0.460	4.911E-7	249	0.052	0.096	6rpqA.pdb.gz
13	PDB:1u10C	0.164	0.292	1.749E-1	241	0.050	0.095	1u10C.pdb.gz	Peptidoglycan amidase MepA is a LAS metallopeptidase
14	PDB:6rohA	0.062	0.036	4.224E-1	1112	0.037	0.015	6rohA.pdb.gz	Structure and autoregulation of a P4-ATPase lipid flippase.
15	PDB:7rd6A	0.072	0.047	5.563E-1	929	0.043	0.022	7rd6A.pdb.gz	Structural basis of the P4B ATPase lipid flippase activity.
16	PDB:7bssA	0.081	0.054	7.743E-1	816	0.048	0.027	7bssA.pdb.gz	Transport Cycle of Plasma Membrane Flippase ATP11C by Cryo-EM.
17	PDB:7dvqX	0.064	0.142	8.182E-1	156	0.028	0.083	7dvqX.pdb.gz	Structure of the activated human minor spliceosome.
18	PDB:6p25B	0.086	0.066	8.645E-1	690	0.043	0.029	6p25B.pdb.gz	Structure of the eukaryotic protein O-mannosyltransferase Pmt1-Pmt2 complex.
19	PDB:5gvxA	0.113	0.132	9.135E-1	386	0.030	0.036	5gvxA.pdb.gz	Structural insight into dephosphorylation by trehalose 6-phosphate phosphatase (OtsB2) from Mycobacterium tuberculosis.
20	PDB:7un3A	0.063	0.051	9.135E-1	649	0.063	0.045	7un3A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q15465	0.0	941	462	1.000	1.000	SHH_HUMAN Sonic hedgehog protein OS=Homo sapiens OX=9606 GN=SHH PE=1 SV=1
2	Q62226	0.0	781	437	0.874	0.924	SHH_MOUSE Sonic hedgehog protein OS=Mus musculus OX=10090 GN=Shh PE=1 SV=2
3	Q63673	0.0	775	437	0.877	0.927	SHH_RAT Sonic hedgehog protein OS=Rattus norvegicus OX=10116 GN=Shh PE=1 SV=1
4	Q90419	0.0	561	416	0.623	0.692	TWHH_DANRE Tiggy-winkle hedgehog protein OS=Danio rerio OX=7955 GN=shhb PE=1 SV=1
5	Q91035	0.0	699	425	0.771	0.838	SHH_CHICK Sonic hedgehog protein OS=Gallus gallus OX=9031 GN=SHH PE=1 SV=1
6	Q92008	0.0	558	418	0.645	0.713	SHH_DANRE Sonic hedgehog protein OS=Danio rerio OX=7955 GN=shha PE=1 SV=1
7	Q98938	1.02e-169	485	408	0.571	0.647	IHH_CHICK Indian hedgehog protein OS=Gallus gallus OX=9031 GN=IHH PE=2 SV=1
8	A3KNS3	1.89e-166	477	413	0.558	0.625	A3KNS3_DANRE Hedgehog protein OS=Danio rerio OX=7955 GN=hha PE=2 SV=1
9	P97812	1.11e-164	472	411	0.552	0.620	IHH_MOUSE Indian hedgehog protein OS=Mus musculus OX=10090 GN=Ihh PE=1 SV=2
10	Q98862	2.64e-162	466	412	0.543	0.609	IHH_DANRE Indian hedgehog B protein OS=Danio rerio OX=7955 GN=ihhb PE=2 SV=1
11	F1LP42	6.94e-161	462	411	0.556	0.625	F1LP42_RAT Hedgehog protein OS=Rattus norvegicus OX=10116 GN=Ihh PE=3 SV=2
12	Q14623	1.12e-159	459	411	0.558	0.628	IHH_HUMAN Indian hedgehog protein OS=Homo sapiens OX=9606 GN=IHH PE=1 SV=4
13	G3V7Y0	2.72e-153	442	396	0.513	0.598	G3V7Y0_RAT Hedgehog protein OS=Rattus norvegicus OX=10116 GN=Dhh PE=3 SV=1
14	Q61488	2.72e-153	442	396	0.513	0.598	DHH_MOUSE Desert hedgehog protein OS=Mus musculus OX=10090 GN=Dhh PE=1 SV=1
15	O43323	6.80e-153	442	396	0.515	0.601	DHH_HUMAN Desert hedgehog protein OS=Homo sapiens OX=9606 GN=DHH PE=1 SV=1
16	Q02936	6.95e-109	332	471	0.437	0.429	HH_DROME Protein hedgehog OS=Drosophila melanogaster OX=7227 GN=hh PE=1 SV=4
17	Q9WUP6	1.03e-62	201	129	0.195	0.698	Q9WUP6_RAT Desert hedgehog protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Dhh PE=2 SV=1
18	Q94129	4.59e-10	63.9	557	0.110	0.092	WRT4_CAEEL Warthog protein 4 OS=Caenorhabditis elegans OX=6239 GN=wrt-4 PE=2 SV=2
19	G5EC21	6.42e-07	54.3	1169	0.110	0.044	QUA1_CAEEL Protein qua-1 OS=Caenorhabditis elegans OX=6239 GN=qua-1 PE=2 SV=1
20	Q21835	3.44e-06	52.0	1137	0.106	0.043	Q21835_CAEEL Ground-like domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=grd-1 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01085 HH_signal	1.4e-85	296.4	Hedgehog amino-terminal signalling domain
2	PF01079 Hint	1.4e-73	258.5	Hint module
3	PF08291 Peptidase_M15_3	0.36	22.4	Peptidase M15

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000297261

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000296575	0.999	Hedgehog-interacting protein
2	9606.ENSP00000298743	0.999	Growth arrest-specific protein 1
3	9606.ENSP00000332353	0.999	Protein patched homolog 1
4	9606.ENSP00000376458	0.999	Cell adhesion molecule-related/down-regulated by oncogenes
5	9606.ENSP00000361266	0.998	Protein patched homolog 2
6	9606.ENSP00000390436	0.997	Zinc finger protein GLI2
7	9606.ENSP00000284476	0.995	Protein dispatched homolog 1
8	9606.ENSP00000377836	0.995	Glypican-3
9	9606.ENSP00000228682	0.994	Zinc finger protein GLI1
10	9606.ENSP00000263816	0.993	Low-density lipoprotein receptor-related protein 2
11	9606.ENSP00000249373	0.990	Smoothened homolog
12	9606.ENSP00000418663	0.989	Brother of CDO
13	9606.ENSP00000438468	0.973	Protein-cysteine N-palmitoyltransferase HHAT
14	9606.ENSP00000321797	0.969	Fibroblast growth factor 8
15	9606.ENSP00000429969	0.962	Signal peptide, CUB domain and EGF like domain containing 2
16	9606.ENSP00000379258	0.939	Transcriptional activator GLI3
17	9606.ENSP00000256442	0.933	G2/mitotic-specific cyclin-B1
18	9606.ENSP00000387310	0.933	Palmitoleoyl-protein carboxylesterase NOTUM
19	9606.ENSP00000302486	0.932	Dual specificity mitogen-activated protein kinase kinase 1
20	9606.ENSP00000245451	0.926	Bone morphogenetic protein 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005113	0.999	patched binding
GO:0140096	0.996	catalytic activity, acting on a protein
GO:0008233	0.992	peptidase activity
GO:0005509	0.946	calcium ion binding
GO:0140677	0.842	molecular function activator activity
GO:0030546	0.792	signaling receptor activator activity
GO:0048018	0.769	receptor ligand activity
GO:0008270	0.660	zinc ion binding
GO:0004175	0.558	endopeptidase activity
GO:0016015	0.395	morphogen activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0050794	0.995	regulation of cellular process
GO:0048522	0.994	positive regulation of cellular process
GO:0048513	0.992	animal organ development
GO:0050896	0.991	response to stimulus
GO:0030154	0.991	cell differentiation
GO:0048731	0.989	system development
GO:0023052	0.988	signaling
GO:0007154	0.988	cell communication
GO:0019222	0.986	regulation of metabolic process
GO:0023051	0.982	regulation of signaling
GO:0060255	0.981	regulation of macromolecule metabolic process
GO:0007399	0.969	nervous system development
GO:0051171	0.964	regulation of nitrogen compound metabolic process
GO:0048519	0.963	negative regulation of biological process
GO:0080090	0.963	regulation of primary metabolic process
GO:0051716	0.961	cellular response to stimulus
GO:0010646	0.956	regulation of cell communication
GO:0009966	0.953	regulation of signal transduction
GO:0031323	0.951	regulation of cellular metabolic process
GO:0010468	0.951	regulation of gene expression
GO:0009888	0.950	tissue development
GO:0048523	0.950	negative regulation of cellular process
GO:0008284	0.942	positive regulation of cell population proliferation
GO:0008589	0.942	regulation of smoothened signaling pathway
GO:0007165	0.937	signal transduction
GO:0009893	0.935	positive regulation of metabolic process
GO:0045880	0.930	positive regulation of smoothened signaling pathway
GO:0010604	0.923	positive regulation of macromolecule metabolic process
GO:0045597	0.920	positive regulation of cell differentiation
GO:0002521	0.919	leukocyte differentiation
GO:0022008	0.913	neurogenesis
GO:0042110	0.907	T cell activation
GO:0007224	0.905	smoothened signaling pathway
GO:0031325	0.902	positive regulation of cellular metabolic process
GO:0009889	0.897	regulation of biosynthetic process
GO:0051239	0.896	regulation of multicellular organismal process
GO:0019219	0.892	regulation of nucleobase-containing compound metabolic process
GO:0042221	0.875	response to chemical
GO:0030217	0.875	T cell differentiation
GO:0009653	0.869	anatomical structure morphogenesis
GO:0071840	0.860	cellular component organization or biogenesis
GO:0044237	0.851	cellular metabolic process
GO:0010556	0.849	regulation of macromolecule biosynthetic process
GO:0051173	0.847	positive regulation of nitrogen compound metabolic process
GO:0031326	0.845	regulation of cellular biosynthetic process
GO:0001655	0.842	urogenital system development
GO:0045165	0.838	cell fate commitment
GO:0060341	0.834	regulation of cellular localization
GO:0006357	0.823	regulation of transcription by RNA polymerase II
GO:0071704	0.822	organic substance metabolic process
GO:0032880	0.818	regulation of protein localization
GO:0016043	0.817	cellular component organization
GO:0007267	0.787	cell-cell signaling
GO:0048699	0.778	generation of neurons
GO:0001501	0.765	skeletal system development
GO:1900180	0.764	regulation of protein localization to nucleus
GO:0044093	0.760	positive regulation of molecular function
GO:0044238	0.758	primary metabolic process
GO:0061458	0.755	reproductive system development
GO:0050790	0.754	regulation of catalytic activity
GO:0030182	0.753	neuron differentiation
GO:0007417	0.745	central nervous system development
GO:0010557	0.738	positive regulation of macromolecule biosynthetic process
GO:0045058	0.735	T cell selection
GO:0043170	0.716	macromolecule metabolic process
GO:0051254	0.716	positive regulation of RNA metabolic process
GO:0009887	0.712	animal organ morphogenesis
GO:0072001	0.712	renal system development
GO:0031328	0.711	positive regulation of cellular biosynthetic process
GO:0006807	0.695	nitrogen compound metabolic process
GO:0045893	0.695	positive regulation of DNA-templated transcription
GO:0007418	0.675	ventral midline development
GO:0010033	0.674	response to organic substance
GO:0000003	0.647	reproduction
GO:0022414	0.638	reproductive process
GO:0010941	0.634	regulation of cell death
GO:0051240	0.615	positive regulation of multicellular organismal process
GO:0003006	0.613	developmental process involved in reproduction
GO:1901564	0.606	organonitrogen compound metabolic process
GO:0048732	0.586	gland development
GO:0060429	0.572	epithelium development
GO:0035295	0.550	tube development
GO:0001822	0.546	kidney development
GO:0048608	0.523	reproductive structure development
GO:0000902	0.520	cell morphogenesis
GO:0009880	0.513	embryonic pattern specification
GO:0030850	0.503	prostate gland development
GO:0060284	0.494	regulation of cell development
GO:0048598	0.479	embryonic morphogenesis
GO:0021915	0.473	neural tube development
GO:0021510	0.471	spinal cord development
GO:0009953	0.462	dorsal/ventral pattern formation
GO:0048646	0.459	anatomical structure formation involved in morphogenesis
GO:0002009	0.454	morphogenesis of an epithelium
GO:0010720	0.450	positive regulation of cell development
GO:0019538	0.427	protein metabolic process
GO:0060537	0.420	muscle tissue development
GO:0009605	0.387	response to external stimulus
GO:0009892	0.332	negative regulation of metabolic process
GO:0010605	0.321	negative regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.998	extracellular space
GO:0016020	0.995	membrane
GO:0012505	0.966	endomembrane system
GO:0071944	0.961	cell periphery
GO:0005622	0.957	intracellular anatomical structure
GO:0043231	0.953	intracellular membrane-bounded organelle
GO:0005886	0.950	plasma membrane
GO:0005737	0.870	cytoplasm
GO:0005634	0.856	nucleus
GO:0031974	0.794	membrane-enclosed lumen
GO:0070013	0.714	intracellular organelle lumen
GO:0030312	0.476	external encapsulating structure
GO:0031012	0.470	extracellular matrix
GO:0031981	0.422	nuclear lumen
GO:0005654	0.338	nucleoplasm
GO:0005829	0.336	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.-.-	0.992	Acting on peptide bonds (peptidases).

[back to server]