StarFunc result for job id Q15466

User Input

>input (257 residues)
MSTSQPGACPCQGAASRPAILYALLSSSLKAVPRPRSRCLCRQHRPVQLCAPHRTCREAL
DVLAKTVAFLRNLPSFWQLPPQDQRRLLQGCWGPLFLLGLAQDAVTFEVAEAPVPSILKK
ILLEEPSSSGGSGQLPDRPQPSLAAVQWLQCCLESFWSLELSPKEYACLKGTILFNPDVP
GLQAASHIGHLQQEAHWVLCEVLEPWCPAAQGRLTRVLLTASTLKSIPTSLLGDLFFRPI
IGDVDIAGLLGDMLLLR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15466	1.000	1.000	5.023E-39	257	1.000	1.000	Q15466.pdb.gz	NR0B2_HUMAN Nuclear receptor subfamily 0 group B member 2 OS=Homo sapiens OX=9606 GN=NR0B2 PE=1 SV=2
2	AFDB:P97947	0.863	0.854	5.878E-30	260	0.786	0.777	P97947.pdb.gz	NR0B2_RAT Nuclear receptor subfamily 0 group B member 2 OS=Rattus norvegicus OX=10116 GN=Nr0b2 PE=1 SV=1
3	AFDB:A3KNP5	0.765	0.746	4.553E-18	264	0.374	0.364	A3KNP5.pdb.gz	A3KNP5_DANRE LOC100001692 protein OS=Danio rerio OX=7955 GN=LOC100001692 PE=2 SV=1
4	AFDB:F1D8P4	0.753	0.420	1.039E-16	470	0.374	0.204	F1D8P4.pdb.gz	F1D8P4_HUMAN Nuclear receptor subfamily 0 group B member 1 OS=Homo sapiens OX=9606 GN=NR0B1 PE=2 SV=1
5	AFDB:Q61066	0.716	0.399	1.703E-14	472	0.323	0.176	Q61066.pdb.gz	NR0B1_MOUSE Nuclear receptor subfamily 0 group B member 1 OS=Mus musculus OX=10090 GN=Nr0b1 PE=1 SV=1
6	AFDB:B3DGQ7	0.644	0.393	8.504E-11	428	0.280	0.168	B3DGQ7.pdb.gz
7	AFDB:Q6PH18	0.653	0.437	1.927E-10	389	0.276	0.183	Q6PH18.pdb.gz	N2F1B_DANRE Nuclear receptor subfamily 2 group F member 1-B OS=Danio rerio OX=7955 GN=nr2f1b PE=2 SV=1
8	AFDB:Q64104	0.642	0.434	2.022E-10	385	0.230	0.153	Q64104.pdb.gz	NR2E1_MOUSE Nuclear receptor subfamily 2 group E member 1 OS=Mus musculus OX=10090 GN=Nr2e1 PE=1 SV=1
9	AFDB:F1D8R0	0.635	0.400	3.965E-10	414	0.280	0.174	F1D8R0.pdb.gz	F1D8R0_HUMAN Ovalbumin upstream promoter-transcription factor II variant 1 OS=Homo sapiens OX=9606 GN=NR2F2 PE=2 SV=1
10	AFDB:Q06726	0.647	0.419	3.965E-10	403	0.272	0.174	Q06726.pdb.gz	NR2F5_DANRE Nuclear receptor subfamily 2 group F member 5 OS=Danio rerio OX=7955 GN=nr2f5 PE=2 SV=1
11	PDB:1g2nA	0.531	0.552	1.796E-6	246	0.214	0.224	1g2nA.pdb.gz	Crystal structure of the ligand-binding domain of the ultraspiracle protein USP, the ortholog of retinoid X receptors in insects.
12	PDB:3dzyA	0.521	0.450	1.173E-5	302	0.179	0.152	3dzyA.pdb.gz	Structure of the intact PPAR-gamma-RXR- nuclear receptor complex on DNA.
13	PDB:7kw7F	0.490	0.487	1.653E-4	259	0.140	0.139	7kw7F.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
14	PDB:6fx0A	0.533	0.572	2.549E-4	238	0.140	0.151	6fx0A.pdb.gz	Structure-based design of Trifarotene (CD5789), a potent and selective RAR gamma agonist for the treatment of acne.
15	PDB:7twaB	0.220	0.242	5.102E-1	223	0.136	0.157	7twaB.pdb.gz	Substrate-Triggered mu-Peroxodiiron(III) Intermediate in the 4-Chloro-l-Lysine-Fragmenting Heme-Oxygenase-like Diiron Oxidase (HDO) BesC: Substrate Dissociation from, and C4 Targeting by, the Intermediate.
16	PDB:3rm5A	0.211	0.121	8.255E-1	521	0.113	0.056	3rm5A.pdb.gz
17	PDB:1h2sA	0.176	0.194	9.536E-1	225	0.101	0.116	1h2sA.pdb.gz	Molecular Basis of Transmembrane Signalling by Sensory Rhodopsin II-Transducer Complex
18	PDB:7vqxR	0.178	0.144	9.536E-1	361	0.117	0.083	7vqxR.pdb.gz	A distinctive ligand recognition mechanism by the human vasoactive intestinal polypeptide receptor 2.
19	PDB:6nwdA	0.153	0.159	1.050	246	0.132	0.138	6nwdA.pdb.gz	X-ray Crystallographic Structure and Oligomerization of Gloeobacter Rhodopsin.
20	PDB:3d9dA	0.126	0.092	1.102	432	0.066	0.039	3d9dA.pdb.gz	Crystal structures of intermediates in the nitroalkane oxidase reaction.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q15466	0.0	512	257	1.000	1.000	NR0B2_HUMAN Nuclear receptor subfamily 0 group B member 2 OS=Homo sapiens OX=9606 GN=NR0B2 PE=1 SV=2
2	P97947	2.61e-140	396	260	0.786	0.777	NR0B2_RAT Nuclear receptor subfamily 0 group B member 2 OS=Rattus norvegicus OX=10116 GN=Nr0b2 PE=1 SV=1
3	Q62227	1.74e-139	394	260	0.790	0.781	NR0B2_MOUSE Nuclear receptor subfamily 0 group B member 2 OS=Mus musculus OX=10090 GN=Nr0b2 PE=1 SV=1
4	A3KNP5	1.60e-51	171	264	0.389	0.379	A3KNP5_DANRE LOC100001692 protein OS=Danio rerio OX=7955 GN=LOC100001692 PE=2 SV=1
5	F1D8P4	1.24e-39	144	470	0.342	0.187	F1D8P4_HUMAN Nuclear receptor subfamily 0 group B member 1 OS=Homo sapiens OX=9606 GN=NR0B1 PE=2 SV=1
6	P51843	1.24e-39	144	470	0.342	0.187	NR0B1_HUMAN Nuclear receptor subfamily 0 group B member 1 OS=Homo sapiens OX=9606 GN=NR0B1 PE=1 SV=2
7	P70503	9.74e-34	129	472	0.315	0.172	NR0B1_RAT Nuclear receptor subfamily 0 group B member 1 OS=Rattus norvegicus OX=10116 GN=Nr0b1 PE=2 SV=1
8	Q61066	4.85e-30	119	472	0.304	0.165	NR0B1_MOUSE Nuclear receptor subfamily 0 group B member 1 OS=Mus musculus OX=10090 GN=Nr0b1 PE=1 SV=1
9	A0A1W2Q6N8	6.82e-24	99.0	273	0.280	0.264	A0A1W2Q6N8_RAT Nuclear receptor subfamily 2, group F, member 1 OS=Rattus norvegicus OX=10116 GN=Nr2f1 PE=4 SV=1
10	F1DAL7	3.38e-23	99.0	372	0.280	0.194	F1DAL7_HUMAN Nuclear receptor subfamily 2 group F member 1 OS=Homo sapiens OX=9606 GN=NR2F1 PE=1 SV=1
11	F1DAL9	5.61e-23	98.6	398	0.280	0.181	F1DAL9_HUMAN Nuclear receptor subfamily 2 group F member 1 OS=Homo sapiens OX=9606 GN=NR2F1 PE=1 SV=1
12	A0A8I6A7N1	5.90e-23	98.6	398	0.280	0.181	A0A8I6A7N1_RAT Nuclear receptor subfamily 2, group F, member 1 OS=Rattus norvegicus OX=10116 GN=Nr2f1 PE=3 SV=1
13	F2Z3S9	8.12e-23	98.2	420	0.280	0.171	F2Z3S9_RAT Nuclear receptor subfamily 2, group F, member 1 OS=Rattus norvegicus OX=10116 GN=Nr2f1 PE=3 SV=1
14	Q60632	8.16e-23	98.2	422	0.280	0.171	COT1_MOUSE COUP transcription factor 1 OS=Mus musculus OX=10090 GN=Nr2f1 PE=2 SV=2
15	P10589	8.64e-23	98.2	423	0.280	0.170	COT1_HUMAN COUP transcription factor 1 OS=Homo sapiens OX=9606 GN=NR2F1 PE=1 SV=1
16	A0A060YH15	8.74e-23	97.8	391	0.276	0.182	A0A060YH15_ONCMY COUP transcription factor 1 OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00037055001 PE=3 SV=1
17	Q06725	1.17e-22	97.8	411	0.276	0.173	N2F1A_DANRE Nuclear receptor subfamily 2 group F member 1-A OS=Danio rerio OX=7955 GN=nr2f1a PE=2 SV=1
18	Q91430	4.61e-22	96.3	422	0.272	0.166	Q91430_DANRE COUP transcription factor 2 OS=Danio rerio OX=7955 GN=svp[40] PE=1 SV=1
19	Q90733	4.83e-22	96.3	410	0.272	0.171	COT2_CHICK COUP transcription factor 2 OS=Gallus gallus OX=9031 GN=NR2F2 PE=2 SV=1
20	Q62681	5.07e-22	96.3	419	0.276	0.169	Q62681_RAT Orphan receptor COUP-TFI OS=Rattus norvegicus OX=10116 GN=Nr2f1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00104 Hormone_recep	5.2e-09	47.6	Ligand-binding domain of nuclear hormone receptor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000254227

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000431162	0.991	EP300-interacting inhibitor of differentiation 1
2	9606.ENSP00000356331	0.984	Nuclear receptor subfamily 5 group A member 2
3	9606.ENSP00000362649	0.984	Histone deacetylase 1
4	9606.ENSP00000405330	0.980	Estrogen receptor
5	9606.ENSP00000447149	0.978	Bile acid receptor
6	9606.ENSP00000385523	0.962	Peroxisome proliferator-activated receptor alpha
7	9606.ENSP00000342136	0.960	Cyclic AMP-responsive element-binding protein 3
8	9606.ENSP00000419692	0.956	Retinoic acid receptor RXR-alpha
9	9606.ENSP00000343925	0.952	Estrogen receptor beta
10	9606.ENSP00000312987	0.937	Hepatocyte nuclear factor 4-alpha
11	9606.ENSP00000398698	0.936	Tumor necrosis factor
12	9606.ENSP00000479618	0.928	Myc proto-oncogene protein
13	9606.ENSP00000378402	0.927	Paired amphipathic helix protein Sin3a
14	9606.ENSP00000216797	0.914	NF-kappa-B inhibitor alpha
15	9606.ENSP00000364678	0.914	Histone-lysine N-methyltransferase EHMT2
16	9606.ENSP00000327251	0.912	Nitric oxide synthase, inducible
17	9606.ENSP00000355904	0.912	Estrogen-related receptor gamma
18	9606.ENSP00000325819	0.907	COUP transcription factor 1
19	9606.ENSP00000354876	0.900	Cytochrome c oxidase subunit 2
20	9606.ENSP00000406229	0.900	Protocadherin Fat 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0140110	0.990	transcription regulator activity
GO:0097159	0.977	organic cyclic compound binding
GO:1901363	0.925	heterocyclic compound binding
GO:0003676	0.907	nucleic acid binding
GO:0003677	0.860	DNA binding
GO:0043565	0.739	sequence-specific DNA binding
GO:0003700	0.407	DNA-binding transcription factor activity
GO:0003690	0.340	double-stranded DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0080090	0.995	regulation of primary metabolic process
GO:0031323	0.994	regulation of cellular metabolic process
GO:0060255	0.992	regulation of macromolecule metabolic process
GO:0009892	0.991	negative regulation of metabolic process
GO:0051171	0.985	regulation of nitrogen compound metabolic process
GO:0048511	0.984	rhythmic process
GO:0048523	0.975	negative regulation of cellular process
GO:1903506	0.966	regulation of nucleic acid-templated transcription
GO:0010468	0.965	regulation of gene expression
GO:0048518	0.954	positive regulation of biological process
GO:0031324	0.936	negative regulation of cellular metabolic process
GO:0009987	0.932	cellular process
GO:0050896	0.927	response to stimulus
GO:0010605	0.925	negative regulation of macromolecule metabolic process
GO:0006355	0.925	regulation of DNA-templated transcription
GO:0009890	0.911	negative regulation of biosynthetic process
GO:0048522	0.903	positive regulation of cellular process
GO:0051172	0.900	negative regulation of nitrogen compound metabolic process
GO:0031327	0.894	negative regulation of cellular biosynthetic process
GO:0008152	0.876	metabolic process
GO:0010558	0.876	negative regulation of macromolecule biosynthetic process
GO:0051253	0.876	negative regulation of RNA metabolic process
GO:1902679	0.873	negative regulation of RNA biosynthetic process
GO:0006357	0.868	regulation of transcription by RNA polymerase II
GO:0045892	0.857	negative regulation of DNA-templated transcription
GO:0071704	0.827	organic substance metabolic process
GO:0051716	0.823	cellular response to stimulus
GO:0044238	0.800	primary metabolic process
GO:0007623	0.779	circadian rhythm
GO:0009893	0.701	positive regulation of metabolic process
GO:0023052	0.570	signaling
GO:0007154	0.568	cell communication
GO:0010604	0.567	positive regulation of macromolecule metabolic process
GO:0007165	0.548	signal transduction
GO:0031325	0.515	positive regulation of cellular metabolic process
GO:0051173	0.480	positive regulation of nitrogen compound metabolic process
GO:0000122	0.461	negative regulation of transcription by RNA polymerase II
GO:0031328	0.448	positive regulation of cellular biosynthetic process
GO:0045935	0.448	positive regulation of nucleobase-containing compound metabolic process
GO:0045893	0.435	positive regulation of DNA-templated transcription
GO:0042221	0.422	response to chemical
GO:0065009	0.357	regulation of molecular function
GO:0051179	0.356	localization
GO:0044237	0.352	cellular metabolic process
GO:0010033	0.330	response to organic substance

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.995	nucleoplasm
GO:0043228	0.970	non-membrane-bounded organelle
GO:0032991	0.969	protein-containing complex
GO:0043232	0.962	intracellular non-membrane-bounded organelle
GO:0005737	0.961	cytoplasm
GO:0016020	0.754	membrane
GO:0000785	0.691	chromatin
GO:0005829	0.412	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]