StarFunc result for job id Q15468

User Input

>input (1287 residues)
MEPIYPFARPQMNTRFPSSRMVPFHFPPSKCALWNPTPTGDFIYLHLSYYRNPKLVVTEK
TIRLAYRHAKQNKKNSSCFLLGSLTADEDEEGVTLTVDRFDPGREVPECLEITPTASLPG
DFLIPCKVHTQELCSREMIVHSVDDFSSALKALQCHICSKDSLDCGKLLSLRVHITSRES
LDSVEFDLHWAAVTLANNFKCTPVKPIPIIPTALARNLSSNLNISQVQGTYKYGYLTMDE
TRKLLLLLESDPKVYSLPLVGIWLSGITHIYSPQVWACCLRYIFNSSVQERVFSESGNFI
IVLYSMTHKEPEFYECFPCDGKIPDFRFQLLTSKETLHLFKNVEPPDKNPIRCELSAESQ
NAETEFFSKASKNFSIKRSSQKLSSGKMPIHDHDSGVEDEDFSPRPIPSPHPVSQKISKI
QPSVPELSLVLDGNFIESNPLPTPLEMVNNENPPLINHLEHLKPLQPQLYDEKHSPEVEA
GEPSLRGIPNQLNQDKPALLRHCKVRQPPAYKKGNPHTRNSIKPSSHNGPSHDIFEKLQT
VSAGNVQNEEYPIRPSTLNSRQSSLAPQSQPHDFVFSPHNSGRPMELQIPTPPLPSYCST
NVCRCCQHHSHIQYSPLNSWQGANTVGSIQDVQSEALQKHSLFHPSGCPALYCNAFCSSS
SPIALRPQGDMGSCSPHSNIEPSPVARPPSHMDLCNPQPCTVCMHTPKTESDNGMMGLSP
DAYRFLTEQDRQLRLLQAQIQRLLEAQSLMPCSPKTTAVEDTVQAGRQMELVSVEAQSSP
GLHMRKGVSIAVSTGASLFWNAAGEDQEPDSQMKQDDTKISSEDMNFSVDINNEVTSLPG
SASSLKAVDIPSFEESNIAVEEEFNQPLSVSNSSLVVRKEPDVPVFFPSGQLAESVSMCL
QTGPTGGASNNSETSEEPKIEHVMQPLLHQPSDNQKIYQDLLGQVNHLLNSSSKETEQPS
TKAVIISHECTRTQNVYHTKKKTHHSRLVDKDCVLNATLKQLRSLGVKIDSPTKVKKNAH
NVDHASVLACISPEAVISGLNCMSFANVGMSGLSPNGVDLSMEANAIALKYLNENQLSQL
SVTRSNQNNCDPFSLLHINTDRSTVGLSLISPNNMSFATKKYMKRYGLLQSSDNSEDEEE
PPDNADSKSEYLLNQNLRSIPEQLGGQKEPSKNDHEIINCSNCESVGTNADTPVLRNITN
EVLQTKAKQQLTEKPAFLVKNLKPSPAVNLRTGKAEFTQHPEKENEGDITIFPESLQPSE
TLKQMNSMNSVGTFLDVKRLRQLPKLF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15468	1.000	1.000	0.000	1287	1.000	1.000	Q15468.pdb.gz	STIL_HUMAN SCL-interrupting locus protein OS=Homo sapiens OX=9606 GN=STIL PE=1 SV=2
2	AFDB:Q60988	0.354	0.360	0.000	1262	0.735	0.750	Q60988.pdb.gz	STIL_MOUSE SCL-interrupting locus protein homolog OS=Mus musculus OX=10090 GN=Stil PE=1 SV=1
3	PDB:4gskB	0.136	0.257	1.037E-7	572	0.027	0.061	4gskB.pdb.gz	Noncanonical E2 recruitment by the autophagy E1 revealed by Atg7-Atg3 and Atg7-Atg10 structures.
4	PDB:4gslA	0.138	0.258	1.077E-6	598	0.032	0.069	4gslA.pdb.gz	Noncanonical E2 recruitment by the autophagy E1 revealed by Atg7-Atg3 and Atg7-Atg10 structures.
5	AFDB:A2A935	0.029	0.029	8.899E-4	1275	0.089	0.090	A2A935.pdb.gz	PRD16_MOUSE Histone-lysine N-methyltransferase PRDM16 OS=Mus musculus OX=10090 GN=Prdm16 PE=1 SV=1
6	AFDB:Q5TC82	0.046	0.050	9.975E-4	1133	0.092	0.105	Q5TC82.pdb.gz	RC3H1_HUMAN Roquin-1 OS=Homo sapiens OX=9606 GN=RC3H1 PE=1 SV=1
7	AFDB:F8W451	0.048	0.052	1.056E-3	1133	0.108	0.123	F8W451.pdb.gz	F8W451_DANRE MLLT10 histone lysine methyltransferase DOT1L cofactor OS=Danio rerio OX=7955 GN=mllt10 PE=4 SV=1
8	AFDB:Q6AI39	0.063	0.072	1.979E-3	1079	0.094	0.112	Q6AI39.pdb.gz	BICRL_HUMAN BRD4-interacting chromatin-remodeling complex-associated protein-like OS=Homo sapiens OX=9606 GN=BICRAL PE=1 SV=2
9	AFDB:Q8CHP0	0.032	0.040	4.401E-3	950	0.106	0.144	Q8CHP0.pdb.gz	ZC3H3_MOUSE Zinc finger CCCH domain-containing protein 3 OS=Mus musculus OX=10090 GN=Zc3h3 PE=1 SV=1
10	AFDB:A0A2R8RZV0	0.031	0.036	7.357E-3	1059	0.095	0.115	A0A2R8RZV0.pdb.gz
11	AFDB:Q9HCH0	0.047	0.046	9.244E-3	1334	0.127	0.123	Q9HCH0.pdb.gz	NCK5L_HUMAN Nck-associated protein 5-like OS=Homo sapiens OX=9606 GN=NCKAP5L PE=1 SV=4
12	AFDB:Q9HAZ2	0.032	0.032	1.545E-2	1276	0.090	0.091	Q9HAZ2.pdb.gz	PRD16_HUMAN Histone-lysine N-methyltransferase PRDM16 OS=Homo sapiens OX=9606 GN=PRDM16 PE=1 SV=3
13	PDB:6oa9G	0.078	0.189	4.660E-2	468	0.010	0.028	6oa9G.pdb.gz	Substrate processing by the Cdc48 ATPase complex is initiated by ubiquitin unfolding.
14	PDB:6gvwB	0.079	0.316	5.224E-2	262	0.020	0.099	6gvwB.pdb.gz	Structural Basis of BRCC36 Function in DNA Repair and Immune Regulation.
15	PDB:6h3cA	0.073	0.299	8.248E-2	255	0.012	0.063	6h3cA.pdb.gz	Structural Basis of BRCC36 Function in DNA Repair and Immune Regulation.
16	PDB:7bt6v	0.034	0.109	1.230E-1	287	0.025	0.111	7bt6v.pdb.gz	Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.
17	PDB:3jckG	0.071	0.300	1.636E-1	257	0.012	0.058	3jckG.pdb.gz	Atomic structure of the 26S proteasome lid reveals the mechanism of deubiquitinase inhibition.
18	PDB:5gm6A	0.057	0.035	3.246E-1	2200	0.025	0.015	5gm6A.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
19	PDB:6ybd8	0.067	0.212	3.246E-1	317	0.014	0.057	6ybd8.pdb.gz
20	PDB:7nacA	0.038	0.102	3.246E-1	266	0.019	0.090	7nacA.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q15468	0.0	2657	1287	1.000	1.000	STIL_HUMAN SCL-interrupting locus protein OS=Homo sapiens OX=9606 GN=STIL PE=1 SV=2
2	Q60988	0.0	1876	1262	0.736	0.750	STIL_MOUSE SCL-interrupting locus protein homolog OS=Mus musculus OX=10090 GN=Stil PE=1 SV=1
3	Q8JGS1	0.0	616	1263	0.399	0.406	STIL_DANRE SCL-interrupting locus protein homolog OS=Danio rerio OX=7955 GN=stil PE=1 SV=2
4	F4HZB2	1.9	35.4	3601	0.019	0.007	BCHA1_ARATH Protein SPIRRIG OS=Arabidopsis thaliana OX=3702 GN=SPI PE=1 SV=1
5	P32604	2.5	34.7	452	0.016	0.044	F26_YEAST Fructose-2,6-bisphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FBP26 PE=1 SV=2
6	Q2VJ58	5.5	32.3	161	0.017	0.137	Q2VJ58_STRPY Immunity factor for SPN OS=Streptococcus pyogenes OX=1314 GN=ifs PE=1 SV=1
7	P0DTU3	9.0	32.3	275	0.018	0.084	TRAR2_HUMAN T cell receptor alpha chain MC.7.G5 OS=Homo sapiens OX=9606 GN=TRA PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15253 STIL_N	2.5e-192	650.8	SCL-interrupting locus protein N-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000360944

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000270861	0.998	Serine/threonine-protein kinase PLK4
2	9606.ENSP00000371308	0.998	Centromere protein J
3	9606.ENSP00000287482	0.988	Spindle assembly abnormal protein 6 homolog
4	9606.ENSP00000356379	0.976	Abnormal spindle-like microcephaly-associated protein
5	9606.ENSP00000370337	0.957	Centrosomal protein of 152 kDa
6	9606.ENSP00000257287	0.941	Centrosomal protein of 135 kDa
7	9606.ENSP00000343818	0.927	CDK5 regulatory subunit-associated protein 2
8	9606.ENSP00000297261	0.926	Sonic hedgehog protein
9	9606.ENSP00000384792	0.919	WD repeat-containing protein 62
10	9606.ENSP00000332353	0.915	Protein patched homolog 1
11	9606.ENSP00000342924	0.855	Microcephalin
12	9606.ENSP00000355922	0.853	Centromere protein F
13	9606.ENSP00000255674	0.850	Rotatin
14	9606.ENSP00000336524	0.845	Centrosomal protein of 63 kDa
15	9606.ENSP00000274026	0.840	Cyclin-A2
16	9606.ENSP00000251496	0.825	Condensin complex subunit 3
17	9606.ENSP00000260731	0.823	Kinesin-like protein KIF11
18	9606.ENSP00000302530	0.812	Mitotic checkpoint serine/threonine-protein kinase BUB1
19	9606.ENSP00000358813	0.810	Dual specificity protein kinase TTK
20	9606.ENSP00000427550	0.799	Centrosomal protein of 192 kDa

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	0.999	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050794	0.990	regulation of cellular process
GO:0022402	0.969	cell cycle process
GO:0048522	0.966	positive regulation of cellular process
GO:0016043	0.959	cellular component organization
GO:0033043	0.958	regulation of organelle organization
GO:0045787	0.956	positive regulation of cell cycle
GO:0007098	0.947	centrosome cycle
GO:0051179	0.944	localization
GO:0010564	0.932	regulation of cell cycle process
GO:1903047	0.918	mitotic cell cycle process
GO:0007051	0.918	spindle organization
GO:1901987	0.913	regulation of cell cycle phase transition
GO:0051298	0.910	centrosome duplication
GO:0007346	0.897	regulation of mitotic cell cycle
GO:0090068	0.897	positive regulation of cell cycle process
GO:1901990	0.858	regulation of mitotic cell cycle phase transition
GO:0051641	0.857	cellular localization
GO:0032886	0.834	regulation of microtubule-based process
GO:0033036	0.830	macromolecule localization
GO:1902850	0.828	microtubule cytoskeleton organization involved in mitosis
GO:0044087	0.827	regulation of cellular component biogenesis
GO:0033365	0.821	protein localization to organelle
GO:0010638	0.769	positive regulation of organelle organization
GO:0045931	0.710	positive regulation of mitotic cell cycle
GO:1901989	0.710	positive regulation of cell cycle phase transition
GO:1902115	0.706	regulation of organelle assembly
GO:0046605	0.703	regulation of centrosome cycle
GO:1901992	0.703	positive regulation of mitotic cell cycle phase transition
GO:0010824	0.692	regulation of centrosome duplication
GO:0044380	0.659	protein localization to cytoskeleton
GO:1902117	0.641	positive regulation of organelle assembly
GO:0072698	0.627	protein localization to microtubule cytoskeleton
GO:1902806	0.617	regulation of cell cycle G1/S phase transition
GO:1902808	0.613	positive regulation of cell cycle G1/S phase transition
GO:1900087	0.508	positive regulation of G1/S transition of mitotic cell cycle
GO:0051493	0.489	regulation of cytoskeleton organization
GO:1905508	0.485	protein localization to microtubule organizing center
GO:0007052	0.425	mitotic spindle organization
GO:0019222	0.396	regulation of metabolic process
GO:0050896	0.381	response to stimulus
GO:0060255	0.373	regulation of macromolecule metabolic process
GO:0080090	0.371	regulation of primary metabolic process
GO:0051171	0.370	regulation of nitrogen compound metabolic process
GO:0031323	0.313	regulation of cellular metabolic process
GO:0051495	0.302	positive regulation of cytoskeleton organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005737	1.000	cytoplasm
GO:0005813	1.000	centrosome
GO:0005814	0.999	centriole
GO:0005829	0.872	cytosol
GO:0120099	0.761	procentriole replication complex
GO:0043227	0.693	membrane-bounded organelle
GO:0031981	0.507	nuclear lumen
GO:0005654	0.482	nucleoplasm
GO:0005819	0.435	spindle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]