StarFunc result for job id Q15475

User Input

>input (284 residues)
MSMLPSFGFTQEQVACVCEVLQQGGNLERLGRFLWSLPACDHLHKNESVLKAKAVVAFHR
GNFRELYKILESHQFSPHNHPKLQQLWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRT
IWDGEETSYCFKEKSRGVLREWYAHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDR
AAEAKERENTENNNSSSNKQNQLSPLEGGKPLMSSSEEEFSPPQSPDQNSVLLLQGNMGH
ARSSNYSLPGLTASQPSHGLQTHQHQLQDSLLGPLTSSLVDLGS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:G3V970	0.772	0.772	1.386E-38	284	0.993	0.993	G3V970.pdb.gz	G3V970_RAT SIX homeobox 1 OS=Rattus norvegicus OX=10116 GN=Six1 PE=3 SV=1
2	AFDB:Q6DHF9	0.514	0.516	8.141E-34	283	0.859	0.862	Q6DHF9.pdb.gz	SIX1A_DANRE Homeobox protein six1a OS=Danio rerio OX=7955 GN=six1a PE=2 SV=2
3	AFDB:Q98TH1	0.674	0.665	4.049E-32	288	0.757	0.747	Q98TH1.pdb.gz	Q98TH1_DANRE Homeobox protein SIX2 OS=Danio rerio OX=7955 GN=six2.1 PE=2 SV=1
4	AFDB:Q62232	0.721	0.694	1.293E-31	296	0.789	0.757	Q62232.pdb.gz	SIX2_MOUSE Homeobox protein SIX2 OS=Mus musculus OX=10090 GN=Six2 PE=1 SV=2
5	AFDB:Q27350	0.665	0.463	8.617E-26	416	0.637	0.435	Q27350.pdb.gz	SO_DROME Protein sine oculis OS=Drosophila melanogaster OX=7227 GN=so PE=2 SV=1
6	AFDB:O73709	0.522	0.508	3.613E-22	293	0.496	0.481	O73709.pdb.gz	O73709_DANRE Homeobox protein Six6 OS=Danio rerio OX=7955 GN=SIX3 PE=2 SV=1
7	PDB:4egcA	0.405	0.214	4.081E-22	539	0.585	0.308	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
8	AFDB:O93282	0.575	0.630	2.175E-21	256	0.475	0.527	O93282.pdb.gz	O93282_DANRE Homeobox protein Six7 OS=Danio rerio OX=7955 GN=six7 PE=2 SV=1
9	AFDB:Q95RW8	0.582	0.358	2.417E-21	487	0.468	0.273	Q95RW8.pdb.gz	OPTIX_DROME Protein Optix OS=Drosophila melanogaster OX=7227 GN=Optix PE=2 SV=1
10	AFDB:Q9ET75	0.435	0.369	1.894E-20	337	0.486	0.409	Q9ET75.pdb.gz	Q9ET75_RAT Homeobox protein Six3 OS=Rattus norvegicus OX=10116 GN=Six3 PE=1 SV=1
11	AFDB:O73916	0.522	0.542	2.105E-20	272	0.451	0.471	O73916.pdb.gz	SIX3_ORYLA Homeobox protein SIX3 OS=Oryzias latipes OX=8090 GN=six3 PE=1 SV=1
12	PDB:5wqlA	0.180	0.187	2.831E-1	270	0.099	0.104	5wqlA.pdb.gz	Structural basis of adaptor-mediated protein degradation by the tail-specific PDZ-protease Prc
13	PDB:2hi3A	0.187	0.626	4.319E-1	73	0.060	0.233	2hi3A.pdb.gz
14	PDB:7rroI1	0.182	0.244	5.624E-1	192	0.144	0.214	7rroI1.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
15	PDB:1xi4A	0.178	0.044	6.589E-1	1630	0.081	0.014	1xi4A.pdb.gz
16	PDB:5g05F	0.199	0.131	7.322E-1	460	0.070	0.043	5g05F.pdb.gz	Molecular Mechanism of Apc/C Activation by Mitotic Phosphorylation.
17	PDB:7qe7Y	0.154	0.104	7.322E-1	502	0.085	0.048	7qe7Y.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
18	PDB:5l4kP	0.202	0.146	7.719E-1	456	0.067	0.042	5l4kP.pdb.gz
19	PDB:4bujB	0.247	0.078	8.138E-1	1367	0.092	0.019	4bujB.pdb.gz
20	PDB:4i2wA	0.187	0.077	8.138E-1	904	0.085	0.027	4i2wA.pdb.gz	The myosin chaperone UNC-45 is organized in tandem modules to support myofilament formation in C. elegans.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	G3V970	0.0	583	284	0.993	0.993	G3V970_RAT SIX homeobox 1 OS=Rattus norvegicus OX=10116 GN=Six1 PE=3 SV=1
2	Q15475	0.0	587	284	1.000	1.000	SIX1_HUMAN Homeobox protein SIX1 OS=Homo sapiens OX=9606 GN=SIX1 PE=1 SV=1
3	Q62231	0.0	583	284	0.993	0.993	SIX1_MOUSE Homeobox protein SIX1 OS=Mus musculus OX=10090 GN=Six1 PE=1 SV=2
4	Q6NZ04	0.0	546	284	0.919	0.919	SIX1B_DANRE Homeobox protein six1b OS=Danio rerio OX=7955 GN=six1b PE=1 SV=1
5	Q6DHF9	2.39e-173	481	283	0.859	0.862	SIX1A_DANRE Homeobox protein six1a OS=Danio rerio OX=7955 GN=six1a PE=2 SV=2
6	Q98TH1	4.52e-150	423	288	0.757	0.747	Q98TH1_DANRE Homeobox protein SIX2 OS=Danio rerio OX=7955 GN=six2.1 PE=2 SV=1
7	Q9NPC8	3.48e-144	408	291	0.746	0.729	SIX2_HUMAN Homeobox protein SIX2 OS=Homo sapiens OX=9606 GN=SIX2 PE=1 SV=1
8	Q62232	3.64e-144	408	296	0.764	0.733	SIX2_MOUSE Homeobox protein SIX2 OS=Mus musculus OX=10090 GN=Six2 PE=1 SV=2
9	Q27350	6.69e-119	348	416	0.581	0.397	SO_DROME Protein sine oculis OS=Drosophila melanogaster OX=7227 GN=so PE=2 SV=1
10	Q61321	1.12e-88	281	775	0.475	0.174	SIX4_MOUSE Homeobox protein SIX4 OS=Mus musculus OX=10090 GN=Six4 PE=1 SV=1
11	Q7T3G8	1.20e-88	266	245	0.472	0.547	Q7T3G8_DANRE Homeobox protein SIX6 OS=Danio rerio OX=7955 GN=Six6 PE=2 SV=1
12	Q9UIU6	1.79e-88	281	781	0.454	0.165	SIX4_HUMAN Homeobox protein SIX4 OS=Homo sapiens OX=9606 GN=SIX4 PE=1 SV=2
13	O73708	1.74e-87	264	294	0.454	0.439	O73708_DANRE Homeobox protein SIX3 OS=Danio rerio OX=7955 GN=six3 PE=2 SV=1
14	O95475	1.78e-87	263	246	0.461	0.533	SIX6_HUMAN Homeobox protein SIX6 OS=Homo sapiens OX=9606 GN=SIX6 PE=1 SV=2
15	O93282	2.08e-87	263	256	0.437	0.484	O93282_DANRE Homeobox protein Six7 OS=Danio rerio OX=7955 GN=six7 PE=2 SV=1
16	O73709	4.53e-87	263	293	0.454	0.440	O73709_DANRE Homeobox protein Six6 OS=Danio rerio OX=7955 GN=SIX3 PE=2 SV=1
17	O95343	1.41e-86	263	332	0.454	0.389	SIX3_HUMAN Homeobox protein SIX3 OS=Homo sapiens OX=9606 GN=SIX3 PE=1 SV=1
18	Q9QZ28	1.44e-86	260	246	0.461	0.533	SIX6_MOUSE Homeobox protein SIX6 OS=Mus musculus OX=10090 GN=Six6 PE=1 SV=2
19	A0A0G2JWI0	1.50e-86	264	350	0.511	0.414	A0A0G2JWI0_RAT SIX homeobox 3 OS=Rattus norvegicus OX=10116 GN=Six3 PE=3 SV=2
20	Q62233	1.85e-86	263	333	0.454	0.387	SIX3_MOUSE Homeobox protein SIX3 OS=Mus musculus OX=10090 GN=Six3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05920 Homeobox_KN	1.8e-09	48.7	Homeobox KN domain
2	PF00046 Homeodomain	3.1e-11	54.3	Homeodomain
3	PF01381 HTH_3	30	16.1	Helix-turn-helix
4	PF04383 KilA-N	5.5e+02	11.8	KilA-N domain
5	PF03863 Phage_mat-A	4.8e+02	11.0	Phage maturation protein
6	PF16878 SIX1_SD	9.3e-45	163.2	Transcriptional regulator, SIX1, N-terminal SD domain
7	PF15943 YdaS_antitoxin	2.4e+02	13.2	Putative antitoxin of bacterial toxin-antitoxin system, YdaS/YdaT

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000247182

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000342626	0.999	Eyes absent homolog 1
2	9606.ENSP00000333640	0.998	Eyes absent homolog 2
3	9606.ENSP00000432770	0.989	Eyes absent homolog 4
4	9606.ENSP00000362978	0.971	Eyes absent homolog 3
5	9606.ENSP00000482245	0.921	Dachshund homolog 1
6	9606.ENSP00000395654	0.912	Transcription activator BRG1
7	9606.ENSP00000323588	0.881	Transcription factor SOX-2
8	9606.ENSP00000358677	0.835	T-box transcription factor TBX18
9	9606.ENSP00000251020	0.790	Sal-like protein 1
10	9606.ENSP00000404100	0.774	Paired box protein Pax-6
11	9606.ENSP00000375921	0.755	Paired box protein Pax-3
12	9606.ENSP00000359319	0.751	Paired box protein Pax-2
13	9606.ENSP00000222598	0.747	Homeobox protein DLX-5
14	9606.ENSP00000295108	0.680	Neurogenic differentiation factor 1
15	9606.ENSP00000241651	0.666	Myogenin
16	9606.ENSP00000362217	0.665	Dachshund homolog 2
17	9606.ENSP00000250003	0.658	Myoblast determination protein 1
18	9606.ENSP00000480514	0.657	Calcium load-activated calcium channel
19	9606.ENSP00000265748	0.636	Anillin
20	9606.ENSP00000317580	0.634	Neurogenin-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000981	0.999	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000978	0.999	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0008134	0.982	transcription factor binding
GO:0001221	0.968	transcription coregulator binding
GO:0001216	0.962	DNA-binding transcription activator activity
GO:0001228	0.912	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0001223	0.643	transcription coactivator binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.998	biological regulation
GO:0050794	0.992	regulation of cellular process
GO:0009987	0.989	cellular process
GO:0048856	0.979	anatomical structure development
GO:0048518	0.972	positive regulation of biological process
GO:0009893	0.956	positive regulation of metabolic process
GO:0032501	0.947	multicellular organismal process
GO:0060255	0.879	regulation of macromolecule metabolic process
GO:0006355	0.873	regulation of DNA-templated transcription
GO:0010604	0.869	positive regulation of macromolecule metabolic process
GO:0050896	0.857	response to stimulus
GO:0007275	0.840	multicellular organism development
GO:0051173	0.828	positive regulation of nitrogen compound metabolic process
GO:0031325	0.827	positive regulation of cellular metabolic process
GO:0006357	0.810	regulation of transcription by RNA polymerase II
GO:0051716	0.790	cellular response to stimulus
GO:0045935	0.753	positive regulation of nucleobase-containing compound metabolic process
GO:0009891	0.693	positive regulation of biosynthetic process
GO:0051254	0.676	positive regulation of RNA metabolic process
GO:0048513	0.675	animal organ development
GO:0042221	0.655	response to chemical
GO:0048731	0.651	system development
GO:0045893	0.549	positive regulation of DNA-templated transcription
GO:0070887	0.524	cellular response to chemical stimulus
GO:0045944	0.522	positive regulation of transcription by RNA polymerase II
GO:0009719	0.502	response to endogenous stimulus
GO:0071495	0.477	cellular response to endogenous stimulus
GO:0048519	0.468	negative regulation of biological process
GO:0001101	0.465	response to acid chemical
GO:0009653	0.451	anatomical structure morphogenesis
GO:0071229	0.425	cellular response to acid chemical
GO:0048523	0.417	negative regulation of cellular process
GO:1902074	0.369	response to salt
GO:0010033	0.349	response to organic substance
GO:1901698	0.311	response to nitrogen compound
GO:0030154	0.303	cell differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.969	nuclear lumen
GO:0005654	0.960	nucleoplasm
GO:0032991	0.677	protein-containing complex
GO:0005737	0.339	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]