StarFunc result for job id Q15477

User Input

>input (1246 residues)
MMETERLVLPPPDPLDLPLRAVELGCTGHWELLNLPGAPESSLPHGLPPCAPDLQQEAEQ
LFLSSPAWLPLHGVEHSARKWQRKTDPWSLLAVLGAPVPSDLQAQRHPTTGQILGYKEVL
LENTNLSATTSLSLRRPPGPASQSLWGNPTQYPFWPGGMDEPTITDLNTREEAEEEIDFE
KDLLTIPPGFKKGMDFAPKDCPTPAPGLLSLSCMLEPLDLGGGDEDENEAVGQPGGPRGD
TVSASPCSAPLARASSLEDLVLKEASTAVSTPEAPEPPSQEQWAIPVDATSPVGDFYRLI
PQPAFQWAFEPDVFQKQAILHLERHDSVFVAAHTSAGKTVVAEYAIALAQKHMTRTIYTS
PIKALSNQKFRDFRNTFGDVGLLTGDVQLHPEASCLIMTTEILRSMLYSGSDVIRDLEWV
IFDEVHYINDVERGVVWEEVLIMLPDHVSIILLSATVPNALEFADWIGRLKRRQIYVIST
VTRPVPLEHYLFTGNSSKTQGELFLLLDSRGAFHTKGYYAAVEAKKERMSKHAQTFGAKQ
PTHQGGPAQDRGVYLSLLASLRTRAQLPVVVFTFSRGRCDEQASGLTSLDLTTSSEKSEI
HLFLQRCLARLRGSDRQLPQVLHMSELLNRGLGVHHSGILPILKEIVEMLFSRGLVKVLF
ATETFAMGVNMPARTVVFDSMRKHDGSTFRDLLPGEYVQMAGRAGRRGLDPTGTVILLCK
GRVPEMADLHRMMMGKPSQLQSQFRLTYTMILNLLRVDALRVEDMMKRSFSEFPSRKDSK
AHEQALAELTKRLGALEEPDMTGQLVDLPEYYSWGEELTETQHMIQRRIMESVNGLKSLS
AGRVVVVKNQEHHNALGVILQVSSNSTSRVFTTLVLCDKPLSQDPQDRGPATAEVPYPDD
LVGFKLFLPEGPCDHTVVKLQPGDMAAITTKVLRVNGEKILEDFSKRQQPKFKKDPPLAA
VTTAVQELLRLAQAHPAGPPTLDPVNDLQLKDMSVVEGGLRARKLEELIQGAQCVHSPRF
PAQYLKLRERMQIQKEMERLRFLLSDQSLLLLPEYHQRVEVLRTLGYVDEAGTVKLAGRV
ACAMSSHELLLTELMFDNALSTLRPEEIAALLSGLVCQSPGDAGDQLPNTLKQGIERVRA
VAKRIGEVQVACGLNQTVEEFVGELNFGLVEVVYEWARGMPFSELAGLSGTPEGLVVRCI
QRLAEMCRSLRGAARLVGEPVLGAKMETAATLLRRDIVFAASLYTQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7qdyA	0.787	0.835	0.000	1169	0.936	0.997	7qdyA.pdb.gz	The human SKI complex regulates channeling of ribosome-bound RNA to the exosome via an intrinsic gatekeeping mechanism.
2	AFDB:Q15477	1.000	1.000	0.000	1246	1.000	1.000	Q15477.pdb.gz	SKI2_HUMAN Superkiller complex protein 2 OS=Homo sapiens OX=9606 GN=SKIC2 PE=1 SV=3
3	AFDB:Q9BI21	0.811	0.843	3.855E-103	1197	0.412	0.429	Q9BI21.pdb.gz	Q9BI21_DROME Putative helicase Ski2 OS=Drosophila melanogaster OX=7227 GN=tst PE=2 SV=1
4	AFDB:O59801	0.773	0.793	6.694E-96	1213	0.382	0.392	O59801.pdb.gz	SKI2_SCHPO Putative ATP-dependent RNA helicase C550.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC550.03c PE=3 SV=1
5	AFDB:F4JAA5	0.743	0.691	4.860E-95	1347	0.403	0.373	F4JAA5.pdb.gz	SKI2_ARATH DExH-box ATP-dependent RNA helicase DExH11 OS=Arabidopsis thaliana OX=3702 GN=SKI2 PE=1 SV=1
6	AFDB:P35207	0.721	0.701	1.254E-85	1287	0.365	0.354	P35207.pdb.gz	SKI2_YEAST Antiviral helicase SKI2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SKI2 PE=1 SV=2
7	AFDB:O14232	0.555	0.610	1.092E-75	1117	0.304	0.339	O14232.pdb.gz	MTR4_SCHPO ATP-dependent RNA helicase mtr4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mtr4 PE=1 SV=1
8	AFDB:F1QD61	0.529	0.635	2.349E-75	1034	0.291	0.350	F1QD61.pdb.gz
9	AFDB:Q9Y134	0.540	0.624	2.570E-75	1055	0.282	0.333	Q9Y134.pdb.gz	Q9Y134_DROME L.2.35Df OS=Drosophila melanogaster OX=7227 GN=Mtr4 PE=1 SV=1
10	AFDB:P42285	0.525	0.624	7.210E-74	1042	0.293	0.350	P42285.pdb.gz	MTREX_HUMAN Exosome RNA helicase MTR4 OS=Homo sapiens OX=9606 GN=MTREX PE=1 SV=3
11	AFDB:P47047	0.523	0.606	1.857E-73	1073	0.289	0.336	P47047.pdb.gz	MTR4_YEAST ATP-dependent RNA helicase DOB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MTR4 PE=1 SV=1
12	PDB:6ro1A	0.550	0.715	7.798E-72	919	0.274	0.372	6ro1A.pdb.gz	The MTR4 helicase recruits nuclear adaptors of the human RNA exosome using distinct arch-interacting motifs.
13	PDB:5mc6h	0.755	0.834	1.511E-68	1121	0.357	0.397	5mc6h.pdb.gz	The cryo-EM structure of a ribosome-Ski2-Ski3-Ski8 helicase complex.
14	PDB:6iegA	0.507	0.720	2.421E-63	872	0.262	0.375	6iegA.pdb.gz	NRDE2 negatively regulates exosome functions by inhibiting MTR4 recruitment and exosome interaction.
15	PDB:4xgtA	0.504	0.649	6.236E-63	961	0.274	0.355	4xgtA.pdb.gz
16	PDB:7z4yB	0.512	0.679	1.839E-62	930	0.275	0.369	7z4yB.pdb.gz
17	PDB:2xgjB	0.496	0.788	1.104E-59	777	0.246	0.395	2xgjB.pdb.gz	Structural Analysis Reveals the Characteristic Features of Mtr4, a Dexh Helicase Involved in Nuclear RNA Processing and Surveillance.
18	PDB:7d4iM4	0.554	0.692	4.058E-58	978	0.271	0.346	7d4iM4.pdb.gz	Cryo-EM structure of 90S small ribosomal precursors complex with Dhr1
19	PDB:6lqsM4	0.502	0.709	1.168E-52	874	0.262	0.373	6lqsM4.pdb.gz	Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
20	PDB:6d6qM	0.512	0.891	1.278E-52	709	0.242	0.426	6d6qM.pdb.gz	Helicase-Dependent RNA Decay Illuminated by a Cryo-EM Structure of a Human Nuclear RNA Exosome-MTR4 Complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F4JAA5	0.0	845	1347	0.405	0.375	SKI2_ARATH DExH-box ATP-dependent RNA helicase DExH11 OS=Arabidopsis thaliana OX=3702 GN=SKI2 PE=1 SV=1
2	O14232	0.0	585	1117	0.307	0.342	MTR4_SCHPO ATP-dependent RNA helicase mtr4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mtr4 PE=1 SV=1
3	O59801	0.0	836	1213	0.390	0.401	SKI2_SCHPO Putative ATP-dependent RNA helicase C550.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC550.03c PE=3 SV=1
4	P35207	0.0	748	1287	0.380	0.368	SKI2_YEAST Antiviral helicase SKI2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SKI2 PE=1 SV=2
5	P42285	0.0	593	1042	0.284	0.340	MTREX_HUMAN Exosome RNA helicase MTR4 OS=Homo sapiens OX=9606 GN=MTREX PE=1 SV=3
6	P47047	0.0	596	1073	0.285	0.331	MTR4_YEAST ATP-dependent RNA helicase DOB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MTR4 PE=1 SV=1
7	Q15477	0.0	2550	1246	1.000	1.000	SKI2_HUMAN Superkiller complex protein 2 OS=Homo sapiens OX=9606 GN=SKIC2 PE=1 SV=3
8	Q6P7X6	0.0	601	1034	0.295	0.355	Q6P7X6_DANRE Superkiller viralicidic activity 2-like 2 OS=Danio rerio OX=7955 GN=skiv2l2 PE=1 SV=1
9	Q873J5	0.0	577	1106	0.291	0.328	Q873J5_NEUCS FRQ-interacting RNA helicase OS=Neurospora crassa OX=5141 GN=B9B11.040 PE=1 SV=1
10	Q9BI21	0.0	924	1197	0.420	0.437	Q9BI21_DROME Putative helicase Ski2 OS=Drosophila melanogaster OX=7227 GN=tst PE=2 SV=1
11	Q9VCH8	0.0	922	1197	0.420	0.437	Q9VCH8_DROME LD23303p OS=Drosophila melanogaster OX=7227 GN=tst PE=2 SV=2
12	Q9XIF2	0.0	572	988	0.286	0.360	MTR4_ARATH DExH-box ATP-dependent RNA helicase DExH9 OS=Arabidopsis thaliana OX=3702 GN=MTR4 PE=2 SV=1
13	Q9Y134	0.0	587	1055	0.287	0.338	Q9Y134_DROME L.2.35Df OS=Drosophila melanogaster OX=7227 GN=Mtr4 PE=1 SV=1
14	Q9ZVW2	0.0	571	995	0.299	0.375	HEN2_ARATH DExH-box ATP-dependent RNA helicase DExH10 OS=Arabidopsis thaliana OX=3702 GN=HEN2 PE=1 SV=2
15	O13799	2.25e-170	535	1030	0.269	0.325	YE02_SCHPO Uncharacterized helicase C17H9.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17H9.02 PE=1 SV=1
16	Q38AL9	6.20e-167	523	950	0.290	0.380	Q38AL9_TRYB2 ATP-dependent DEAD/H RNA helicase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.3220 PE=4 SV=1
17	P9WMR1	4.16e-82	291	906	0.157	0.215	HELY_MYCTU Probable helicase HelY OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=helY PE=1 SV=1
18	B9DFG3	4.73e-81	292	1171	0.157	0.167	ISE2_ARATH DExH-box ATP-dependent RNA helicase DExH15 chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ISE2 PE=1 SV=2
19	D3Z4R1	2.35e-29	129	1434	0.101	0.088	HFM1_MOUSE Probable ATP-dependent DNA helicase HFM1 OS=Mus musculus OX=10090 GN=Hfm1 PE=3 SV=2
20	Q588V7	1.63e-25	117	2154	0.100	0.058	TEB_ARATH Helicase and polymerase-containing protein TEBICHI OS=Arabidopsis thaliana OX=3702 GN=TEB PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00270 DEAD	7.4e-13	60.2	DEAD/DEAH box helicase
2	PF08148 DSHCT	1e-36	137.5	DSHCT (NUC185) domain
3	PF12029 DUF3516	2.1e+02	12.4	Domain of unknown function (DUF3516)
4	PF09378 HAS-barrel	3.2e+02	12.9	HAS barrel domain
5	PF00271 Helicase_C	0.022	26.5	Helicase conserved C-terminal domain
6	PF04851 ResIII	1.1	20.7	Type III restriction enzyme, res subunit
7	PF13234 rRNA_proc-arch	1.7e-43	161.0	rRNA-processing arch domain
8	PF17911 Ski2_N	1.9e-28	110.4	Ski2 N-terminal region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000364543

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000267973	0.999	WD repeat-containing protein 61
2	9606.ENSP00000351596	0.999	Tetratricopeptide repeat protein 37
3	9606.ENSP00000264951	0.976	5'-3' exoribonuclease 1
4	9606.ENSP00000315476	0.970	Exosome complex component RRP41
5	9606.ENSP00000366135	0.965	Exosome component 10
6	9606.ENSP00000359939	0.960	Exosome complex component CSL4
7	9606.ENSP00000221233	0.949	Exosome complex component RRP46
8	9606.ENSP00000323046	0.949	Exosome complex component RRP40
9	9606.ENSP00000356811	0.949	HBS1-like protein
10	9606.ENSP00000366997	0.941	Exosome complex exonuclease RRP44
11	9606.ENSP00000398597	0.940	Exosome complex component MTR3
12	9606.ENSP00000265564	0.939	Exosome complex component RRP42
13	9606.ENSP00000368984	0.937	Exosome complex component RRP45
14	9606.ENSP00000374354	0.922	Exosome complex component RRP43
15	9606.ENSP00000366396	0.899	5'-3' exoribonuclease 2
16	9606.ENSP00000361433	0.889	Exosome complex component RRP4
17	9606.ENSP00000321711	0.834	DIS3-like exonuclease 1
18	9606.ENSP00000443113	0.834	Zinc finger CCHC-type containing 7
19	9606.ENSP00000364498	0.830	Decapping and exoribonuclease protein
20	9606.ENSP00000352678	0.824	ATP-dependent RNA helicase SUPV3L1, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003724	1.000	RNA helicase activity
GO:1901363	0.966	heterocyclic compound binding
GO:0097159	0.966	organic cyclic compound binding
GO:0003676	0.953	nucleic acid binding
GO:0003723	0.943	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.992	organic substance metabolic process
GO:0050789	0.991	regulation of biological process
GO:0044238	0.988	primary metabolic process
GO:0044237	0.987	cellular metabolic process
GO:0006807	0.984	nitrogen compound metabolic process
GO:0060255	0.983	regulation of macromolecule metabolic process
GO:0043170	0.980	macromolecule metabolic process
GO:0050794	0.970	regulation of cellular process
GO:0034641	0.938	cellular nitrogen compound metabolic process
GO:1901360	0.881	organic cyclic compound metabolic process
GO:0046483	0.869	heterocycle metabolic process
GO:0006725	0.866	cellular aromatic compound metabolic process
GO:0006139	0.860	nucleobase-containing compound metabolic process
GO:0090304	0.848	nucleic acid metabolic process
GO:0051171	0.704	regulation of nitrogen compound metabolic process
GO:0010468	0.674	regulation of gene expression
GO:0044260	0.668	cellular macromolecule metabolic process
GO:0031323	0.655	regulation of cellular metabolic process
GO:0016070	0.620	RNA metabolic process
GO:0080090	0.476	regulation of primary metabolic process
GO:0048518	0.464	positive regulation of biological process
GO:0048519	0.424	negative regulation of biological process
GO:0048522	0.424	positive regulation of cellular process
GO:0071840	0.356	cellular component organization or biogenesis
GO:0010467	0.326	gene expression
GO:0019219	0.324	regulation of nucleobase-containing compound metabolic process
GO:0009056	0.309	catabolic process
GO:0009889	0.306	regulation of biosynthetic process
GO:0009892	0.304	negative regulation of metabolic process
GO:0009893	0.301	positive regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.999	protein-containing complex
GO:0005829	0.998	cytosol
GO:0031981	0.954	nuclear lumen
GO:0005654	0.944	nucleoplasm
GO:0043232	0.316	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.6.4.13	1.000	RNA helicase.

[back to server]