StarFunc result for job id Q15526

User Input

>input (300 residues)
MAAVAALQLGLRAAGLGRAPASAAWRSVLRVSPRPGVAWRPSRCGSSAAEASATKAEDDS
FLQWVLLLIPVTAFGLGTWQVQRRKWKLNLIAELESRVLAEPVPLPADPMELKNLEYRPV
KVRGCFDHSKELYMMPRTMVDPVREAREGGLISSSTQSGAYVVTPFHCTDLGVTILVNRG
FVPRKKVNPETRQKGQIEGEVDLIGMVRLTETRQPFVPENNPERNHWHYRDLEAMARITG
AEPIFIDANFQSTVPGGPIGGQTRVTLRNEHLQYIVTWYGLSAATSYLWFKKFLRGTPGV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15526	1.000	1.000	4.115E-59	300	1.000	1.000	Q15526.pdb.gz	SURF1_HUMAN Surfeit locus protein 1 OS=Homo sapiens OX=9606 GN=SURF1 PE=1 SV=1
2	AFDB:P09925	0.852	0.835	3.997E-49	306	0.767	0.752	P09925.pdb.gz	SURF1_MOUSE Surfeit locus protein 1 OS=Mus musculus OX=10090 GN=Surf1 PE=1 SV=3
3	AFDB:A1L248	0.806	0.783	4.937E-43	309	0.603	0.586	A1L248.pdb.gz	A1L248_DANRE SURF1-like protein OS=Danio rerio OX=7955 GN=im:6898613 PE=1 SV=1
4	AFDB:Q9U4F3	0.759	0.759	8.002E-31	300	0.423	0.423	Q9U4F3.pdb.gz	SURF1_DROME SURF1-like protein OS=Drosophila melanogaster OX=7227 GN=Surf1 PE=2 SV=1
5	AFDB:Q9Y810	0.679	0.701	9.594E-23	290	0.287	0.297	Q9Y810.pdb.gz	SHY1_SCHPO Cytochrome oxidase assembly protein shy1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=shy1 PE=3 SV=1
6	AFDB:P53266	0.667	0.530	1.066E-21	389	0.303	0.234	P53266.pdb.gz	SHY1_YEAST Cytochrome oxidase assembly protein SHY1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SHY1 PE=1 SV=1
7	AFDB:Q9SE51	0.632	0.545	2.332E-21	354	0.290	0.246	Q9SE51.pdb.gz	SURF1_ARATH Surfeit locus protein 1 OS=Arabidopsis thaliana OX=3702 GN=SURF1 PE=2 SV=1
8	AFDB:Q5APC5	0.625	0.532	2.967E-21	359	0.267	0.223	Q5APC5.pdb.gz	Q5APC5_CANAL SURF1-like protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SHY1 PE=3 SV=1
9	AFDB:Q9LP74	0.525	0.422	2.880E-15	384	0.210	0.164	Q9LP74.pdb.gz	SURFL_ARATH Surfeit locus protein 1-like OS=Arabidopsis thaliana OX=3702 GN=At1g48510 PE=3 SV=2
10	AFDB:Q385U9	0.503	0.448	2.069E-13	346	0.200	0.173	Q385U9.pdb.gz	Q385U9_TRYB2 SURF1-like protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.2280 PE=3 SV=1
11	PDB:1e1tA	0.138	0.094	3.402E-2	485	0.107	0.066	1e1tA.pdb.gz	Active Site of Lysyl-tRNA Synthetase: Structural Studies of the Adenylation Reaction
12	PDB:3k81D	0.121	0.261	1.359E-1	106	0.050	0.142	3k81D.pdb.gz
13	PDB:4v6wAX	0.142	0.260	1.627E-1	143	0.043	0.091	4v6wAX.pdb.gz	Structures of the human and Drosophila 80S ribosome.
14	PDB:6aggZ	0.126	0.095	2.199E-1	420	0.053	0.038	6aggZ.pdb.gz	Structure of tRNA-Modifying Enzyme TiaS and Motions of Its Substrate Binding Zinc Ribbon.
15	PDB:6xtx7	0.210	0.116	2.199E-1	598	0.060	0.030	6xtx7.pdb.gz	CryoEM structures of human CMG-ATP gamma S-DNA and CMG-AND-1 complexes.
16	PDB:4xgtA	0.097	0.042	2.634E-1	961	0.087	0.027	4xgtA.pdb.gz
17	PDB:7uy7A	0.147	0.089	2.634E-1	552	0.047	0.025	7uy7A.pdb.gz	Structure of Tetrahymena telomerase-bound CST with polymerase alpha-primase.
18	PDB:6u426U	0.107	0.070	2.798E-1	569	0.067	0.035	6u426U.pdb.gz	Structure of the Decorated Ciliary Doublet Microtubule.
19	PDB:7a1gc	0.147	0.268	2.798E-1	144	0.040	0.083	7a1gc.pdb.gz	A structural inventory of native ribosomal ABCE1-43S pre-initiation complexes.
20	PDB:5gpkB	0.116	0.159	4.015E-1	207	0.073	0.106	5gpkB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q15526	0.0	617	300	1.000	1.000	SURF1_HUMAN Surfeit locus protein 1 OS=Homo sapiens OX=9606 GN=SURF1 PE=1 SV=1
2	P09925	4.13e-167	468	306	0.790	0.775	SURF1_MOUSE Surfeit locus protein 1 OS=Mus musculus OX=10090 GN=Surf1 PE=1 SV=3
3	A1L248	5.22e-132	379	309	0.593	0.576	A1L248_DANRE SURF1-like protein OS=Danio rerio OX=7955 GN=im:6898613 PE=1 SV=1
4	Q9U4F3	1.46e-73	229	300	0.410	0.410	SURF1_DROME SURF1-like protein OS=Drosophila melanogaster OX=7227 GN=Surf1 PE=2 SV=1
5	Q9Y810	2.13e-37	136	290	0.287	0.297	SHY1_SCHPO Cytochrome oxidase assembly protein shy1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=shy1 PE=3 SV=1
6	Q5APC5	1.68e-27	111	359	0.263	0.220	Q5APC5_CANAL SURF1-like protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SHY1 PE=3 SV=1
7	P53266	8.95e-25	104	389	0.220	0.170	SHY1_YEAST Cytochrome oxidase assembly protein SHY1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SHY1 PE=1 SV=1
8	Q9SE51	2.33e-24	102	354	0.273	0.232	SURF1_ARATH Surfeit locus protein 1 OS=Arabidopsis thaliana OX=3702 GN=SURF1 PE=2 SV=1
9	Q385U9	2.20e-09	60.1	346	0.123	0.107	Q385U9_TRYB2 SURF1-like protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.2280 PE=3 SV=1
10	Q9LP74	7.56e-04	43.1	384	0.203	0.159	SURFL_ARATH Surfeit locus protein 1-like OS=Arabidopsis thaliana OX=3702 GN=At1g48510 PE=3 SV=2
11	Q9VM12	0.078	36.6	294	0.063	0.065	Q9VM12_DROME MIP26555p1 OS=Drosophila melanogaster OX=7227 GN=Dmel\CG5958 PE=1 SV=1
12	P80663	7.6	29.3	106	0.043	0.123	FSHB_STRCA Follitropin subunit beta OS=Struthio camelus OX=8801 GN=FSHB PE=1 SV=1
13	A0A443HK81	9.1	30.8	2276	0.053	0.007	VDTA1_BYSSP Non-reducing polyketide synthase VdtA OS=Byssochlamys spectabilis OX=264951 GN=VdtA PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02104 SURF1	1e-48	177.7	SURF1 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000361042

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000016171	0.984	Cytochrome c oxidase assembly protein COX15 homolog
2	9606.ENSP00000261643	0.955	Protoheme IX farnesyltransferase, mitochondrial
3	9606.ENSP00000307786	0.955	Cytochrome c
4	9606.ENSP00000255390	0.937	Protein SCO1 homolog, mitochondrial
5	9606.ENSP00000361057	0.930	Surfeit locus protein 4
6	9606.ENSP00000444433	0.907	Protein SCO2 homolog, mitochondrial
7	9606.ENSP00000317159	0.900	Cytochrome c1, heme protein, mitochondrial
8	9606.ENSP00000299335	0.892	Cytochrome c oxidase assembly protein COX11, mitochondrial
9	9606.ENSP00000354499	0.887	Cytochrome c oxidase subunit 1
10	9606.ENSP00000203407	0.883	Cytochrome b-c1 complex subunit 1, mitochondrial
11	9606.ENSP00000354876	0.880	Cytochrome c oxidase subunit 2
12	9606.ENSP00000317780	0.878	Cytochrome c oxidase subunit 5A, mitochondrial
13	9606.ENSP00000361032	0.870	Surfeit 2
14	9606.ENSP00000483491	0.870	Mitochondrial inner membrane protein OXA1L
15	9606.ENSP00000263774	0.827	NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial
16	9606.ENSP00000315774	0.826	NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial
17	9606.ENSP00000354762	0.810	Cytochrome c oxidase assembly factor 3 homolog, mitochondrial
18	9606.ENSP00000261070	0.796	Cytochrome c oxidase copper chaperone
19	9606.ENSP00000446524	0.787	Cytochrome c oxidase assembly protein COX14
20	9606.ENSP00000406327	0.785	Cytochrome c oxidase protein 20 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0022857	0.995	transmembrane transporter activity
GO:0016491	0.995	oxidoreductase activity
GO:0004129	0.989	cytochrome-c oxidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0044237	0.979	cellular metabolic process
GO:0033108	0.949	mitochondrial respiratory chain complex assembly
GO:0015980	0.927	energy derivation by oxidation of organic compounds
GO:0045333	0.917	cellular respiration
GO:0017004	0.862	cytochrome complex assembly
GO:0009060	0.855	aerobic respiration
GO:0008535	0.847	respiratory chain complex IV assembly
GO:0033617	0.673	mitochondrial cytochrome c oxidase assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031966	0.995	mitochondrial membrane
GO:0019866	0.994	organelle inner membrane
GO:0005743	0.969	mitochondrial inner membrane
GO:0032991	0.904	protein-containing complex
GO:0005746	0.863	mitochondrial respirasome
GO:0098803	0.478	respiratory chain complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.-.-.-	0.995	Oxidoreductases.
RHEA:11436	0.989	4 Fe(II)-[cytochrome c] + 8 H(+)(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H(+)(out) + 2 H2O
EC:7.1.1.9	0.989	cytochrome-c oxidase.

[back to server]