StarFunc result for job id Q15528

User Input

>input (200 residues)
MAQQRALPQSKETLLQSYNKRLKDDIKSIMDNFTEIIKTAKIEDETQVSRATQGEQDNYE
MHVRAANIVRAGESLMKLVSDLKQFLILNDFPSVNEAIDQRNQQLRTLQEECDRKLITLR
DEISIDLYELEEEYYSSSSSLCEANDLPLCEAYGRLDLDTDSADGLSAPLLASPEPSAGP
LQVAAPAHSHAGGPGPTEHA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15528	1.000	1.000	9.695E-28	200	1.000	1.000	Q15528.pdb.gz	MED22_HUMAN Mediator of RNA polymerase II transcription subunit 22 OS=Homo sapiens OX=9606 GN=MED22 PE=1 SV=2
2	PDB:7enav	0.424	0.617	6.310E-15	134	0.660	0.985	7enav.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
3	AFDB:Q9V439	0.593	0.802	3.980E-12	143	0.430	0.601	Q9V439.pdb.gz	MED22_DROME Mediator of RNA polymerase II transcription subunit 22 OS=Drosophila melanogaster OX=7227 GN=MED22 PE=1 SV=1
4	AFDB:Q8LCH5	0.548	0.691	3.728E-7	154	0.235	0.305	Q8LCH5.pdb.gz	MD22B_ARATH Mediator of RNA polymerase II transcription subunit 22b OS=Arabidopsis thaliana OX=3702 GN=MED22B PE=1 SV=1
5	AFDB:A4IG65	0.242	0.115	1.420E-2	618	0.140	0.045	A4IG65.pdb.gz	A4IG65_DANRE Kinesin light chain OS=Danio rerio OX=7955 GN=MGC162288 PE=1 SV=1
6	AFDB:Q9D7S9	0.464	0.430	2.088E-2	219	0.125	0.114	Q9D7S9.pdb.gz	CHMP5_MOUSE Charged multivesicular body protein 5 OS=Mus musculus OX=10090 GN=Chmp5 PE=1 SV=1
7	AFDB:O18397	0.270	0.082	2.227E-2	784	0.130	0.033	O18397.pdb.gz	O18397_DROME Oxysterol-binding protein OS=Drosophila melanogaster OX=7227 GN=Osbp PE=2 SV=2
8	AFDB:P58391	0.279	0.098	3.493E-2	732	0.130	0.036	P58391.pdb.gz	KCNN3_MOUSE Small conductance calcium-activated potassium channel protein 3 OS=Mus musculus OX=10090 GN=Kcnn3 PE=1 SV=2
9	AFDB:Q9LPN5	0.403	0.357	3.725E-2	235	0.190	0.162	Q9LPN5.pdb.gz	VP601_ARATH Vacuolar protein sorting-associated protein 60.1 OS=Arabidopsis thaliana OX=3702 GN=VPS60-1 PE=1 SV=1
10	AFDB:Q9VBQ9	0.245	0.257	3.972E-2	189	0.165	0.175	Q9VBQ9.pdb.gz	MED28_DROME Mediator of RNA polymerase II transcription subunit 28 OS=Drosophila melanogaster OX=7227 GN=MED28 PE=1 SV=1
11	AFDB:A8MX29	0.246	0.161	4.517E-2	333	0.135	0.081	A8MX29.pdb.gz	A8MX29_HUMAN Kinesin light chain OS=Homo sapiens OX=9606 GN=KLC2 PE=1 SV=1
12	PDB:5n9jZ	0.355	0.584	6.135E-2	119	0.060	0.101	5n9jZ.pdb.gz
13	PDB:5svaU	0.212	0.248	1.416E-1	156	0.080	0.103	5svaU.pdb.gz	Structure of a Complete Mediator-RNA Polymerase II Pre-Initiation Complex.
14	PDB:6tz402	0.293	0.329	1.610E-1	176	0.075	0.085	6tz402.pdb.gz
15	PDB:5n9jB	0.234	0.337	5.123E-1	133	0.100	0.150	5n9jB.pdb.gz
16	PDB:3hajA	0.216	0.168	5.463E-1	286	0.125	0.087	3hajA.pdb.gz	Molecular mechanism of membrane constriction and tubulation mediated by the F-BAR protein Pacsin/Syndapin.
17	PDB:7n6g3I	0.296	0.164	5.826E-1	401	0.105	0.052	7n6g3I.pdb.gz	Cryo-EM structure of an active central apparatus.
18	PDB:5oqmk	0.176	0.245	6.213E-1	127	0.115	0.181	5oqmk.pdb.gz	Structures of transcription pre-initiation complex with TFIIH and Mediator.
19	PDB:6tuyA	0.245	0.091	7.066E-1	667	0.030	0.009	6tuyA.pdb.gz	Novel non-covalent LSD1 inhibitors endowed with anticancer effects in leukemia and solid tumor cellular models.
20	PDB:5ew5A	0.264	0.124	8.570E-1	490	0.045	0.018	5ew5A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q15528	7.84e-148	410	200	1.000	1.000	MED22_HUMAN Mediator of RNA polymerase II transcription subunit 22 OS=Homo sapiens OX=9606 GN=MED22 PE=1 SV=2
2	Q62276	6.06e-127	357	200	0.950	0.950	MED22_MOUSE Mediator of RNA polymerase II transcription subunit 22 OS=Mus musculus OX=10090 GN=Med22 PE=1 SV=2
3	Q9V439	2.10e-59	184	143	0.435	0.608	MED22_DROME Mediator of RNA polymerase II transcription subunit 22 OS=Drosophila melanogaster OX=7227 GN=MED22 PE=1 SV=1
4	Q8LCH5	2.64e-21	87.8	154	0.230	0.299	MD22B_ARATH Mediator of RNA polymerase II transcription subunit 22b OS=Arabidopsis thaliana OX=3702 GN=MED22B PE=1 SV=1
5	Q9SA42	1.11e-19	83.2	150	0.225	0.300	MD22A_ARATH Mediator of RNA polymerase II transcription subunit 22a OS=Arabidopsis thaliana OX=3702 GN=MED22A PE=1 SV=1
6	Q8K0G8	0.57	33.1	717	0.160	0.045	ESRP2_MOUSE Epithelial splicing regulatory protein 2 OS=Mus musculus OX=10090 GN=Esrp2 PE=1 SV=1
7	Q9NXG0	0.63	33.1	1405	0.155	0.022	CNTLN_HUMAN Centlein OS=Homo sapiens OX=9606 GN=CNTLN PE=1 SV=6
8	Q28021	1.9	32.0	1388	0.170	0.024	ROCK2_BOVIN Rho-associated protein kinase 2 OS=Bos taurus OX=9913 GN=ROCK2 PE=1 SV=1
9	V5NBV4	1.9	31.6	284	0.180	0.127	TPM_MACRS Tropomyosin Mac r 1.0101 OS=Macrobrachium rosenbergii OX=79674 PE=1 SV=1
10	Q9H6T0	2.5	31.2	727	0.105	0.029	ESRP2_HUMAN Epithelial splicing regulatory protein 2 OS=Homo sapiens OX=9606 GN=ESRP2 PE=1 SV=1
11	M3TYT0	3.3	31.2	1388	0.170	0.024	ROCK2_PIG Rho-associated protein kinase 2 OS=Sus scrofa OX=9823 GN=ROCK2 PE=1 SV=1
12	M1H607	4.2	30.4	284	0.175	0.123	TPM_PORPE Tropomyosin Por p 1.0101 OS=Portunus pelagicus OX=80836 PE=1 SV=1
13	P70336	4.9	30.4	1388	0.230	0.033	ROCK2_MOUSE Rho-associated protein kinase 2 OS=Mus musculus OX=10090 GN=Rock2 PE=1 SV=1
14	A0A386CAB9	5.6	30.4	1355	0.090	0.013	NLRP1_DANRE NACHT, LRR and PYD domains-containing protein 1 homolog OS=Danio rerio OX=7955 GN=nlrp1 PE=1 SV=1
15	Q62868	6.3	30.0	1388	0.230	0.033	ROCK2_RAT Rho-associated protein kinase 2 OS=Rattus norvegicus OX=10116 GN=Rock2 PE=1 SV=2
16	Q8SWZ8	6.5	29.6	204	0.105	0.103	Q8SWZ8_DROME RH49505p OS=Drosophila melanogaster OX=7227 GN=CG9471 PE=2 SV=1
17	Q9VH72	6.5	29.6	204	0.105	0.103	Q9VH72_DROME TA01656p1 OS=Drosophila melanogaster OX=7227 GN=BVR PE=1 SV=1
18	A0A2P9DU05	6.6	30.0	1388	0.170	0.024	A0A2P9DU05_HUMAN Rho-associated protein kinase OS=Homo sapiens OX=9606 GN=ROCK2 PE=2 SV=1
19	O75116	6.6	30.0	1388	0.170	0.024	ROCK2_HUMAN Rho-associated protein kinase 2 OS=Homo sapiens OX=9606 GN=ROCK2 PE=1 SV=4
20	E9PF63	7.8	30.0	1145	0.170	0.030	E9PF63_HUMAN non-specific serine/threonine protein kinase OS=Homo sapiens OX=9606 GN=ROCK2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06179 Med22	6.7e-33	124.4	Surfeit locus protein 5 subunit 22 of Mediator complex
2	PF14681 UPRTase	3e+02	12.3	Uracil phosphoribosyltransferase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000482438

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000251871	0.999	Mediator of RNA polymerase II transcription subunit 17
2	9606.ENSP00000293777	0.999	Mediator of RNA polymerase II transcription subunit 11
3	9606.ENSP00000362948	0.998	Mediator of RNA polymerase II transcription subunit 18
4	9606.ENSP00000255764	0.997	Mediator of RNA polymerase II transcription subunit 10
5	9606.ENSP00000258648	0.997	Mediator of RNA polymerase II transcription subunit 4
6	9606.ENSP00000282892	0.997	Mediator of RNA polymerase II transcription subunit 21
7	9606.ENSP00000265350	0.994	Mediator of RNA polymerase II transcription subunit 20
8	9606.ENSP00000286317	0.994	Mediator of RNA polymerase II transcription subunit 7
9	9606.ENSP00000337340	0.994	Mediator of RNA polymerase II transcription subunit 19
10	9606.ENSP00000297347	0.993	Mediator of RNA polymerase II transcription subunit 30
11	9606.ENSP00000370938	0.993	Cyclin-dependent kinase 8
12	9606.ENSP00000481920	0.993	Mediator of RNA polymerase II transcription subunit 6
13	9606.ENSP00000290663	0.992	Mediator of RNA polymerase II transcription subunit 8
14	9606.ENSP00000300651	0.992	Mediator of RNA polymerase II transcription subunit 1
15	9606.ENSP00000323720	0.989	Mediator of RNA polymerase II transcription subunit 14
16	9606.ENSP00000314343	0.987	Mediator of RNA polymerase II transcription subunit 29
17	9606.ENSP00000357047	0.985	Mediator of RNA polymerase II transcription subunit 23
18	9606.ENSP00000363193	0.983	Mediator of RNA polymerase II transcription subunit 12
19	9606.ENSP00000325612	0.981	Mediator of RNA polymerase II transcription subunit 16
20	9606.ENSP00000357907	0.981	Cyclin dependent kinase 19

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.558	catalytic activity
GO:0003712	0.372	transcription coregulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0019222	0.995	regulation of metabolic process
GO:0060255	0.992	regulation of macromolecule metabolic process
GO:0019219	0.990	regulation of nucleobase-containing compound metabolic process
GO:0071704	0.980	organic substance metabolic process
GO:0010468	0.973	regulation of gene expression
GO:0009889	0.967	regulation of biosynthetic process
GO:0051252	0.960	regulation of RNA metabolic process
GO:0010556	0.959	regulation of macromolecule biosynthetic process
GO:0031326	0.959	regulation of cellular biosynthetic process
GO:1903506	0.952	regulation of nucleic acid-templated transcription
GO:0009987	0.931	cellular process
GO:0043170	0.930	macromolecule metabolic process
GO:0006355	0.929	regulation of DNA-templated transcription
GO:0044238	0.901	primary metabolic process
GO:0006357	0.856	regulation of transcription by RNA polymerase II
GO:0006807	0.819	nitrogen compound metabolic process
GO:0048518	0.509	positive regulation of biological process
GO:0048522	0.480	positive regulation of cellular process
GO:0010604	0.386	positive regulation of macromolecule metabolic process
GO:0044237	0.380	cellular metabolic process
GO:0031325	0.358	positive regulation of cellular metabolic process
GO:0051173	0.313	positive regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0032991	0.993	protein-containing complex
GO:0005737	0.963	cytoplasm
GO:0090575	0.946	RNA polymerase II transcription regulator complex
GO:0070847	0.933	core mediator complex
GO:0016592	0.899	mediator complex
GO:0005829	0.359	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]