StarFunc result for job id Q15532

User Input

>input (418 residues)
MSVAFAAPRQRGKGEITPAAIQKMLDDNNHLIQCIMDSQNKGKTSECSQYQQMLHTNLVY
LATIADSNQNMQSLLPAPPTQNMPMGPGGMNQSGPPPPPRSHNMPSDGMVGGGPPAPHMQ
NQMNGQMPGPNHMPMQGPGPNQLNMTNSSMNMPSSSHGSMGGYNHSVPSSQSMPVQNQMT
MSQGQPMGNYGPRPNMSMQPNQGPMMHQQPPSQQYNMPQGGGQHYQGQQPPMGMMGQVNQ
GNHMMGQRQIPPYRPPQQGPPQQYSGQEDYYGDQYSHGGQGPPEGMNQQYYPDGHNDYGY
QQPSYPEQGYDRPYEDSSQHYYEGGNSQYGQQQDAYQGPPPQQGYPPQQQQYPGQQGYPG
QQQGYGPSQGGPGPQYPNYPQGQGQQYGGYRPTQPGPPQPPQQRPYGYDQGQYGNYQQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A4PIV7	0.191	0.166	1.396E-49	488	0.981	0.840	A4PIV7.pdb.gz	A4PIV7_HUMAN Fusion protein SYT-SSX1 OS=Homo sapiens OX=9606 GN=SYT-SSX1 PE=1 SV=1
2	AFDB:A4PIW0	0.212	0.195	6.078E-45	457	0.907	0.829	A4PIW0.pdb.gz	A4PIW0_HUMAN Fusion protein SYT-SSX2 OS=Homo sapiens OX=9606 GN=SYT-SSX2 PE=1 SV=1
3	AFDB:Q8BW22	0.206	0.213	3.688E-29	402	0.620	0.644	Q8BW22.pdb.gz	CREST_MOUSE Calcium-responsive transactivator OS=Mus musculus OX=10090 GN=Ss18l1 PE=1 SV=1
4	AFDB:Q920B0	0.091	0.044	5.252E-2	1035	0.170	0.069	Q920B0.pdb.gz	FRM4B_MOUSE FERM domain-containing protein 4B OS=Mus musculus OX=10090 GN=Frmd4b PE=1 SV=2
5	AFDB:Q9CXH7	0.075	0.064	1.932E-1	517	0.151	0.122	Q9CXH7.pdb.gz	SGO1_MOUSE Shugoshin 1 OS=Mus musculus OX=10090 GN=Sgo1 PE=2 SV=1
6	AFDB:O94421	0.124	0.040	5.132E-1	1680	0.153	0.038	O94421.pdb.gz	SNF22_SCHPO SWI/SNF chromatin-remodeling complex subunit snf22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=snf22 PE=1 SV=2
7	AFDB:O62203	0.084	0.035	5.846E-1	1073	0.163	0.063	O62203.pdb.gz	PHM2_CAEEL Pharyngeal muscle protein 2 OS=Caenorhabditis elegans OX=6239 GN=phm-2 PE=1 SV=3
8	AFDB:Q9P2Q2	0.092	0.045	6.239E-1	1039	0.177	0.071	Q9P2Q2.pdb.gz	FRM4A_HUMAN FERM domain-containing protein 4A OS=Homo sapiens OX=9606 GN=FRMD4A PE=1 SV=3
9	AFDB:Q9H2Y7	0.066	0.024	7.107E-1	1883	0.141	0.031	Q9H2Y7.pdb.gz	ZN106_HUMAN Zinc finger protein 106 OS=Homo sapiens OX=9606 GN=ZNF106 PE=1 SV=1
10	AFDB:D4AD99	0.087	0.053	8.641E-1	756	0.184	0.102	D4AD99.pdb.gz	D4AD99_RAT Cytoplasmic polyadenylation element binding protein 3 OS=Rattus norvegicus OX=10116 GN=Cpeb3 PE=1 SV=3
11	PDB:5n9jV	0.139	0.509	1.114	99	0.014	0.061	5n9jV.pdb.gz
12	PDB:1bcfA	0.136	0.340	1.876	158	0.022	0.057	1bcfA.pdb.gz	Structure of a unique twofold symmetric haem-binding site.
13	PDB:7o6eA	0.131	0.289	2.002	177	0.014	0.034	7o6eA.pdb.gz
14	PDB:5svaT	0.105	0.329	2.137	91	0.022	0.099	5svaT.pdb.gz	Structure of a Complete Mediator-RNA Polymerase II Pre-Initiation Complex.
15	PDB:2wtlA	0.138	0.341	2.280	161	0.026	0.068	2wtlA.pdb.gz	Crystal Structure of Bfra from Mycobacterium Tuberculosis:Incorporation of Selenomethionine Results in Cleavage and Demetallation of Haem
16	PDB:3frtB	0.092	0.204	2.280	142	0.019	0.056	3frtB.pdb.gz
17	PDB:4e6kA	0.133	0.337	2.280	157	0.026	0.070	4e6kA.pdb.gz	The Structure of the BfrB-Bfd Complex Reveals Protein-Protein Interactions Enabling Iron Release from Bacterioferritin.
18	PDB:6cnnA	0.131	0.151	2.280	360	0.005	0.006	6cnnA.pdb.gz	Activation mechanism of a human SK-calmodulin channel complex elucidated by cryo-EM structures.
19	PDB:3craA	0.099	0.169	2.598	239	0.024	0.042	3craA.pdb.gz
20	PDB:4gwpC	0.126	0.259	2.598	184	0.033	0.076	4gwpC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A4PIV7	0.0	768	488	0.981	0.840	A4PIV7_HUMAN Fusion protein SYT-SSX1 OS=Homo sapiens OX=9606 GN=SYT-SSX1 PE=1 SV=1
2	A4PIW0	0.0	691	457	0.907	0.829	A4PIW0_HUMAN Fusion protein SYT-SSX2 OS=Homo sapiens OX=9606 GN=SYT-SSX2 PE=1 SV=1
3	Q15532	0.0	772	418	1.000	1.000	SSXT_HUMAN Protein SSXT OS=Homo sapiens OX=9606 GN=SS18 PE=1 SV=3
4	Q4VAX2	0.0	769	418	0.998	0.998	Q4VAX2_HUMAN Synovial sarcoma translocation, chromosome 18 OS=Homo sapiens OX=9606 GN=SS18 PE=1 SV=1
5	Q62280	0.0	747	418	0.962	0.962	SSXT_MOUSE Protein SSXT OS=Mus musculus OX=10090 GN=Ss18 PE=1 SV=2
6	Q8BW22	1.32e-127	376	402	0.610	0.634	CREST_MOUSE Calcium-responsive transactivator OS=Mus musculus OX=10090 GN=Ss18l1 PE=1 SV=1
7	Q91XJ0	1.42e-122	363	401	0.579	0.603	CREST_RAT Calcium-responsive transcription coactivator OS=Rattus norvegicus OX=10116 GN=Ss18l1 PE=1 SV=1
8	O75177	1.67e-122	362	396	0.555	0.586	CREST_HUMAN Calcium-responsive transactivator OS=Homo sapiens OX=9606 GN=SS18L1 PE=1 SV=2
9	Q9BR54	4.38e-20	87.8	128	0.110	0.359	Q9BR54_HUMAN SS18L1 subunit of BAF chromatin remodeling complex (Fragment) OS=Homo sapiens OX=9606 GN=SS18L1 PE=4 SV=1
10	Q9UHA2	3.87e-19	83.6	77	0.091	0.494	S18L2_HUMAN SS18-like protein 2 OS=Homo sapiens OX=9606 GN=SS18L2 PE=1 SV=1
11	Q9MAL9	6.54e-13	69.3	195	0.072	0.154	GIF2_ARATH GRF1-interacting factor 2 OS=Arabidopsis thaliana OX=3702 GN=GIF2 PE=1 SV=1
12	Q93VH6	2.33e-12	68.2	223	0.069	0.130	GIF3_ARATH GRF1-interacting factor 3 OS=Arabidopsis thaliana OX=3702 GN=GIF3 PE=1 SV=1
13	A5HEH4	2.40e-10	62.4	227	0.065	0.119	GIF1_MAIZE GRF-interacting factor 1 OS=Zea mays OX=4577 GN=GIF1 PE=1 SV=1
14	F4HQJ3	5.17e-10	61.6	229	0.060	0.109	F4HQJ3_ARATH GRF1-interacting factor 2 OS=Arabidopsis thaliana OX=3702 GN=GIF2 PE=1 SV=1
15	Q6AVI1	9.18e-10	60.8	227	0.065	0.119	GIF1_ORYSJ GRF-interacting factor 1 OS=Oryza sativa subsp. japonica OX=39947 GN=GIF1 PE=1 SV=1
16	Q8L8A5	2.77e-09	58.9	210	0.067	0.133	GIF1_ARATH GRF1-interacting factor 1 OS=Arabidopsis thaliana OX=3702 GN=GIF1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05030 SSXT	1.6e-25	99.8	SSXT protein (N-terminal region)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000414516

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000379946	0.997	BRD4-interacting chromatin-remodeling complex-associated protein
2	9606.ENSP00000395654	0.997	Transcription activator BRG1
3	9606.ENSP00000263121	0.996	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1
4	9606.ENSP00000254480	0.995	SWI/SNF complex subunit SMARCC1
5	9606.ENSP00000320485	0.995	AT-rich interactive domain-containing protein 1A
6	9606.ENSP00000323967	0.995	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1
7	9606.ENSP00000419765	0.995	Bromodomain-containing protein 9
8	9606.ENSP00000265773	0.994	Probable global transcription activator SNF2L2
9	9606.ENSP00000267064	0.994	SWI/SNF complex subunit SMARCC2
10	9606.ENSP00000344546	0.994	AT-rich interactive domain-containing protein 1B
11	9606.ENSP00000378414	0.994	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1
12	9606.ENSP00000397552	0.994	Actin-like protein 6A
13	9606.ENSP00000392617	0.993	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2
14	9606.ENSP00000262188	0.989	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3
15	9606.ENSP00000338796	0.989	Synovial sarcoma, X breakpoint 2
16	9606.ENSP00000160382	0.981	Actin-like protein 6B
17	9606.ENSP00000341805	0.977	PHD finger protein 10
18	9606.ENSP00000436901	0.970	Zinc finger protein ubi-d4
19	9606.ENSP00000479526	0.964	Zinc finger protein DPF3
20	9606.ENSP00000313933	0.959	BRD4-interacting chromatin-remodeling complex-associated protein-like

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140110	0.346	transcription regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.992	regulation of cellular process
GO:0048522	0.983	positive regulation of cellular process
GO:0009987	0.955	cellular process
GO:0045893	0.937	positive regulation of DNA-templated transcription
GO:0016043	0.920	cellular component organization
GO:0006357	0.899	regulation of transcription by RNA polymerase II
GO:0032502	0.586	developmental process
GO:0048856	0.580	anatomical structure development
GO:0032501	0.544	multicellular organismal process
GO:0050896	0.537	response to stimulus
GO:0045944	0.465	positive regulation of transcription by RNA polymerase II
GO:0051716	0.308	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016514	1.000	SWI/SNF complex
GO:0031981	0.962	nuclear lumen
GO:0005654	0.941	nucleoplasm
GO:0071565	0.380	nBAF complex
GO:0000779	0.371	condensed chromosome, centromeric region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]