StarFunc result for job id Q15542

User Input

>input (800 residues)
MAALAEEQTEVAVKLEPEGPPTLLPPQAGDGAGEGSGGTTNNGPNGGGGNVAASSSTGGD
GGTPKPTVAVSAAAPAGAAPVPAAAPDAGAPHDRQTLLAVLQFLRQSKLREAEEALRREA
GLLEEAVAGSGAPGEVDSAGAEVTSALLSRVTASAPGPAAPDPPGTGASGATVVSGSASG
PAAPGKVGSVAVEDQPDVSAVLSAYNQQGDPTMYEEYYSGLKHFIECSLDCHRAELSQLF
YPLFVHMYLELVYNQHENEAKSFFEKFHGDQECYYQDDLRVLSSLTKKEHMKGNETMLDF
RTSKFVLRISRDSYQLLKRHLQEKQNNQIWNIVQEHLYIDIFDGMPRSKQQIDAMVGSLA
GEAKREANKSKVFFGLLKEPEIEVPLDDEDEEGENEEGKPKKKKPKKDSIGSKSKKQDPN
APPQNRIPLPELKDSDKLDKIMNMKETTKRVRLGPDCLPSICFYTFLNAYQGLTAVDVTD
DSSLIAGGFADSTVRVWSVTPKKLRSVKQASDLSLIDKESDDVLERIMDEKTASELKILY
GHSGPVYGASFSPDRNYLLSSSEDGTVRLWSLQTFTCLVGYKGHNYPVWDTQFSPYGYYF
VSGGHDRVARLWATDHYQPLRIFAGHLADVNCTRFHPNSNYVATGSADRTVRLWDVLNGN
CVRIFTGHKGPIHSLTFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVCSLRFS
RDGEILASGSMDNTVRLWDAIKAFEDLETDDFTTATGHINLPENSQELLLGTYMTKSTPV
VHLHFTRRNLVLAAGAYSPQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8C092	0.754	0.753	0.000	801	0.966	0.965	Q8C092.pdb.gz	TAF5_MOUSE Transcription initiation factor TFIID subunit 5 OS=Mus musculus OX=10090 GN=Taf5 PE=1 SV=1
2	PDB:7egeE	0.646	0.943	2.393E-87	547	0.684	1.000	7egeE.pdb.gz
3	AFDB:P49846	0.664	0.751	5.690E-66	704	0.381	0.433	P49846.pdb.gz	TAF5_DROME Transcription initiation factor TFIID subunit 5 OS=Drosophila melanogaster OX=7227 GN=Taf5 PE=1 SV=1
4	PDB:6mzcG	0.476	0.789	4.966E-46	473	0.529	0.894	6mzcG.pdb.gz
5	AFDB:O75529	0.365	0.490	8.689E-44	589	0.273	0.370	O75529.pdb.gz	TAF5L_HUMAN TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens OX=9606 GN=TAF5L PE=1 SV=1
6	AFDB:O74319	0.403	0.498	5.873E-43	642	0.251	0.313	O74319.pdb.gz	TAF73_SCHPO Transcription initiation factor TFIID subunit taf73 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=taf73 PE=1 SV=1
7	PDB:6t9iD	0.357	0.501	7.640E-38	566	0.251	0.355	6t9iD.pdb.gz
8	PDB:7ktrB	0.356	0.527	3.417E-37	534	0.255	0.382	7ktrB.pdb.gz	Structure of the human SAGA coactivator complex.
9	AFDB:Q57W14	0.326	0.596	8.589E-23	419	0.110	0.210	Q57W14.pdb.gz	Q57W14_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.29H22.320 PE=4 SV=1
10	AFDB:Q1LV15	0.319	0.592	1.516E-22	415	0.106	0.205	Q1LV15.pdb.gz	DAW1_DANRE Dynein assembly factor with WD repeat domains 1 OS=Danio rerio OX=7955 GN=daw1 PE=1 SV=2
11	AFDB:Q3Y8L7	0.301	0.517	2.413E-22	446	0.091	0.164	Q3Y8L7.pdb.gz	DAW1_CHLRE Dynein assembly factor with WD repeat domains 1 OS=Chlamydomonas reinhardtii OX=3055 GN=DAW1 PE=1 SV=1
12	AFDB:Q8N136	0.306	0.556	2.817E-22	415	0.102	0.198	Q8N136.pdb.gz	DAW1_HUMAN Dynein assembly factor with WD repeat domains 1 OS=Homo sapiens OX=9606 GN=DAW1 PE=1 SV=1
13	PDB:5mzhB	0.315	0.574	2.818E-22	415	0.100	0.193	5mzhB.pdb.gz
14	AFDB:Q8K450	0.357	0.439	4.044E-22	639	0.140	0.175	Q8K450.pdb.gz	SPG16_MOUSE Sperm-associated antigen 16 protein OS=Mus musculus OX=10090 GN=Spag16 PE=1 SV=1
15	AFDB:D3Z7A5	0.303	0.553	4.485E-22	415	0.101	0.195	D3Z7A5.pdb.gz	DAW1_MOUSE Dynein assembly factor with WD repeat domains 1 OS=Mus musculus OX=10090 GN=Daw1 PE=2 SV=1
16	PDB:3jcmB	0.323	0.590	9.945E-21	429	0.095	0.177	3jcmB.pdb.gz	The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
17	PDB:6ttuT	0.308	0.613	1.503E-20	394	0.101	0.206	6ttuT.pdb.gz	NEDD8 nucleates a multivalent cullin-RING-UBE2D ubiquitin ligation assembly.
18	PDB:2h9lA	0.322	0.777	1.703E-19	321	0.087	0.218	2h9lA.pdb.gz
19	PDB:5nnzA	0.290	0.665	1.794E-19	335	0.096	0.230	5nnzA.pdb.gz
20	PDB:5yzgs	0.340	0.706	2.205E-19	374	0.098	0.209	5yzgs.pdb.gz	Structure of a human catalytic step I spliceosome

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P49846	0.0	571	704	0.354	0.402	TAF5_DROME Transcription initiation factor TFIID subunit 5 OS=Drosophila melanogaster OX=7227 GN=Taf5 PE=1 SV=1
2	Q15542	0.0	1657	800	1.000	1.000	TAF5_HUMAN Transcription initiation factor TFIID subunit 5 OS=Homo sapiens OX=9606 GN=TAF5 PE=1 SV=3
3	Q8C092	0.0	1600	801	0.966	0.965	TAF5_MOUSE Transcription initiation factor TFIID subunit 5 OS=Mus musculus OX=10090 GN=Taf5 PE=1 SV=1
4	Q6S7B0	1.53e-142	437	669	0.310	0.371	TAF5_ARATH Transcription initiation factor TFIID subunit 5 OS=Arabidopsis thaliana OX=3702 GN=TAF5 PE=1 SV=1
5	O75529	6.76e-129	399	589	0.282	0.384	TAF5L_HUMAN TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens OX=9606 GN=TAF5L PE=1 SV=1
6	Q91WQ5	4.44e-127	394	589	0.280	0.380	TAF5L_MOUSE TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Mus musculus OX=10090 GN=Taf5l PE=2 SV=1
7	O13282	6.55e-127	395	643	0.282	0.351	TAF5_SCHPO Transcription initiation factor TFIID subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=taf5 PE=1 SV=1
8	P38129	6.12e-122	387	798	0.311	0.312	TAF5_YEAST Transcription initiation factor TFIID subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TAF5 PE=1 SV=1
9	G5EF68	6.32e-102	330	648	0.254	0.313	TAF5_CAEEL Transcription initiation factor TFIID subunit 5 OS=Caenorhabditis elegans OX=6239 GN=taf-5 PE=1 SV=1
10	O74319	7.30e-96	314	642	0.254	0.316	TAF73_SCHPO Transcription initiation factor TFIID subunit taf73 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=taf73 PE=1 SV=1
11	Q9VT91	4.40e-73	259	942	0.221	0.188	Q9VT91_DROME Cannonball OS=Drosophila melanogaster OX=7227 GN=can PE=2 SV=1
12	Q9VCN9	3.58e-47	182	743	0.186	0.201	Q9VCN9_DROME WD repeat-containing protein 55 homolog OS=Drosophila melanogaster OX=7227 GN=wda PE=2 SV=1
13	P61964	1.51e-37	145	334	0.111	0.266	WDR5_HUMAN WD repeat-containing protein 5 OS=Homo sapiens OX=9606 GN=WDR5 PE=1 SV=1
14	P61965	1.51e-37	145	334	0.111	0.266	WDR5_MOUSE WD repeat-containing protein 5 OS=Mus musculus OX=10090 GN=Wdr5 PE=1 SV=1
15	Q498M4	1.51e-37	145	334	0.111	0.266	WDR5_RAT WD repeat-containing protein 5 OS=Rattus norvegicus OX=10116 GN=Wdr5 PE=1 SV=1
16	Q7ZTX2	4.93e-37	144	334	0.111	0.266	Q7ZTX2_DANRE WD repeat domain 5 OS=Danio rerio OX=7955 GN=wu:fk47f04 PE=1 SV=1
17	Q9V3J8	6.04e-37	144	361	0.109	0.241	WDS_DROME Protein will die slowly OS=Drosophila melanogaster OX=7227 GN=wds PE=1 SV=1
18	Q4V8C4	7.43e-37	143	328	0.109	0.265	WDR5B_RAT WD repeat-containing protein 5B OS=Rattus norvegicus OX=10116 GN=Wdr5b PE=2 SV=1
19	Q9M2Z2	6.30e-36	140	317	0.105	0.265	WDR5A_ARATH COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana OX=3702 GN=WDR5A PE=1 SV=1
20	Q54KL5	9.86e-35	137	335	0.110	0.263	WDR5_DICDI WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum OX=44689 GN=wdr5 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	4.5e-11	54.2	Anaphase-promoting complex subunit 4 WD40 domain
2	PF02239 Cytochrom_D1	1.2e+02	12.6	Cytochrome D1 heme domain
3	PF08662 eIF2A	59	15.0	Eukaryotic translation initiation factor eIF2A
4	PF16529 Ge1_WD40	0.037	24.6	WD40 region of Ge1, enhancer of mRNA-decapping protein
5	PF20426 NBCH_WD40	3.5e-15	67.3	Neurobeachin beta propeller domain
6	PF11715 Nup160	0.00014	32.5	Nucleoporin Nup120/160
7	PF07676 PD40	3.5e+02	12.6	WD40-like Beta Propeller Repeat
8	PF14655 RAB3GAP2_N	3.1	18.5	Rab3 GTPase-activating protein regulatory subunit N-terminus
9	PF04494 TFIID_NTD2	2.7e-38	142.7	WD40 associated region in TFIID subunit, NTD2 domain
10	PF08553 VID27	5.8e+02	10.9	VID27 C-terminal WD40-like domain
11	PF00400 WD40	8e-54	189.6	WD domain, G-beta repeat
12	PF17005 WD40_like	2.7e+02	12.3	WD40-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000358854

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000252996	0.999	Transcription initiation factor TFIID subunit 4
2	9606.ENSP00000263974	0.999	Transcription initiation factor TFIID subunit 12
3	9606.ENSP00000299424	0.999	Transcription initiation factor TFIID subunit 10
4	9606.ENSP00000312709	0.999	Transcription initiation factor TFIID subunit 7
5	9606.ENSP00000354633	0.999	Transcription initiation factor TFIID subunit 11
6	9606.ENSP00000355051	0.999	Transcription initiation factor TFIID subunit 13
7	9606.ENSP00000362068	0.999	Transcription initiation factor TFIID subunit 8
8	9606.ENSP00000367406	0.999	Transcription initiation factor TFIID subunit 2
9	9606.ENSP00000370193	0.999	Transcription initiation factor TFIID subunit 9
10	9606.ENSP00000375942	0.999	TATA-box-binding protein
11	9606.ENSP00000399982	0.999	Transcription initiation factor TFIID subunit 6
12	9606.ENSP00000406549	0.999	Transcription initiation factor TFIID subunit 1
13	9606.ENSP00000339917	0.997	Transcription initiation factor TFIID subunit 9B
14	9606.ENSP00000340271	0.997	Transcription initiation factor TFIID subunit 3
15	9606.ENSP00000418379	0.994	Transcription initiation factor TFIID subunit 1-like
16	9606.ENSP00000352925	0.993	Transformation/transcription domain-associated protein
17	9606.ENSP00000360515	0.993	Transcription initiation protein SPT3 homolog
18	9606.ENSP00000307684	0.992	Transcriptional adapter 3
19	9606.ENSP00000225916	0.989	Histone acetyltransferase KAT2A
20	9606.ENSP00000263754	0.986	Histone acetyltransferase KAT2B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140223	1.000	general transcription initiation factor activity
GO:0005515	1.000	protein binding
GO:0003682	0.998	chromatin binding
GO:0003676	0.969	nucleic acid binding
GO:0016251	0.959	RNA polymerase II general transcription initiation factor activity
GO:0003677	0.944	DNA binding
GO:1990841	0.853	promoter-specific chromatin binding
GO:0042802	0.696	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.972	regulation of cellular process
GO:0071704	0.969	organic substance metabolic process
GO:0019222	0.968	regulation of metabolic process
GO:0044238	0.966	primary metabolic process
GO:0009987	0.965	cellular process
GO:0006807	0.964	nitrogen compound metabolic process
GO:0044237	0.959	cellular metabolic process
GO:0080090	0.953	regulation of primary metabolic process
GO:0051171	0.953	regulation of nitrogen compound metabolic process
GO:0043170	0.951	macromolecule metabolic process
GO:0031323	0.950	regulation of cellular metabolic process
GO:0060255	0.947	regulation of macromolecule metabolic process
GO:0071840	0.933	cellular component organization or biogenesis
GO:0019219	0.922	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.914	regulation of gene expression
GO:0048522	0.907	positive regulation of cellular process
GO:2001141	0.906	regulation of RNA biosynthetic process
GO:0006355	0.903	regulation of DNA-templated transcription
GO:0006366	0.881	transcription by RNA polymerase II
GO:0016570	0.840	histone modification
GO:0016043	0.821	cellular component organization
GO:0070647	0.806	protein modification by small protein conjugation or removal
GO:0065004	0.804	protein-DNA complex assembly
GO:0018205	0.796	peptidyl-lysine modification
GO:0016573	0.792	histone acetylation
GO:0060261	0.792	positive regulation of transcription initiation by RNA polymerase II
GO:0016071	0.777	mRNA metabolic process
GO:0016578	0.765	histone deubiquitination
GO:0043966	0.762	histone H3 acetylation
GO:0006367	0.757	transcription initiation at RNA polymerase II promoter
GO:0051123	0.736	RNA polymerase II preinitiation complex assembly
GO:0009299	0.731	mRNA transcription
GO:0042789	0.624	mRNA transcription by RNA polymerase II
GO:0016310	0.571	phosphorylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:1990234	0.995	transferase complex
GO:0140535	0.993	intracellular protein-containing complex
GO:0043232	0.980	intracellular non-membrane-bounded organelle
GO:0140513	0.971	nuclear protein-containing complex
GO:0055029	0.935	nuclear DNA-directed RNA polymerase complex
GO:0016591	0.911	RNA polymerase II, holoenzyme
GO:0005667	0.909	transcription regulator complex
GO:0090575	0.900	RNA polymerase II transcription regulator complex
GO:1902493	0.868	acetyltransferase complex
GO:0005694	0.856	chromosome
GO:0000785	0.843	chromatin
GO:0000123	0.717	histone acetyltransferase complex
GO:0005669	0.698	transcription factor TFIID complex
GO:0005737	0.693	cytoplasm
GO:0070461	0.538	SAGA-type complex
GO:0005856	0.349	cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]