StarFunc result for job id Q15543

User Input

>input (124 residues)
MADEEEDPTFEEENEEIGGGAEGGQGKRKRLFSKELRCMMYGFGDDQNPYTESVDILEDL
VIEFITEMTHKAMSIGRQGRVQVEDIVFLIRKDPRKFARVKDLLTMNEELKRARKAFDEA
NYGS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R089	0.812	0.812	2.719E-18	124	1.000	1.000	A0A024R089.pdb.gz
2	AFDB:Q9VIP1	0.761	0.695	4.066E-13	136	0.677	0.618	Q9VIP1.pdb.gz	Q9VIP1_DROME GEO07843p1 OS=Drosophila melanogaster OX=7227 GN=Taf13 PE=1 SV=1
3	PDB:7edxm	0.616	0.849	7.884E-11	87	0.694	0.989	7edxm.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
4	AFDB:Q6NQH4	0.722	0.711	2.058E-9	126	0.468	0.460	Q6NQH4.pdb.gz	TAF13_ARATH Transcription initiation factor TFIID subunit 13 OS=Arabidopsis thaliana OX=3702 GN=TAF13 PE=1 SV=1
5	AFDB:O60076	0.709	0.786	4.576E-7	111	0.298	0.333	O60076.pdb.gz	TAF13_SCHPO Transcription initiation factor TFIID subunit 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=taf13 PE=3 SV=3
6	AFDB:P11747	0.719	0.545	3.444E-6	167	0.226	0.168	P11747.pdb.gz	TAF13_YEAST Transcription initiation factor TFIID subunit 13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TAF13 PE=1 SV=2
7	AFDB:B0QZW5	0.653	0.228	3.208E-3	382	0.194	0.063	B0QZW5.pdb.gz	B0QZW5_MOUSE SPT3, SAGA and STAGA complex component (Fragment) OS=Mus musculus OX=10090 GN=Supt3 PE=1 SV=1
8	AFDB:O14311	0.686	0.286	3.424E-3	307	0.226	0.091	O14311.pdb.gz	SPT3_SCHPO SAGA complex subunit spt3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=spt3 PE=1 SV=2
9	AFDB:P04913	0.482	0.476	6.152E-3	126	0.145	0.143	P04913.pdb.gz	H2B1_SCHPO Histone H2B-alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=htb1 PE=1 SV=3
10	AFDB:Q9SR71	0.434	0.114	7.479E-3	539	0.161	0.037	Q9SR71.pdb.gz	TAF12_ARATH Transcription initiation factor TFIID subunit 12 OS=Arabidopsis thaliana OX=3702 GN=TAF12 PE=1 SV=1
11	PDB:7pj1B	0.529	0.536	1.029E-2	122	0.121	0.123	7pj1B.pdb.gz
12	AFDB:Q59VP1	0.488	0.472	1.105E-2	130	0.129	0.123	Q59VP1.pdb.gz	H2B2_CANAL Histone H2B.2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=HTB2 PE=3 SV=3
13	PDB:6gejG	0.551	0.691	1.335E-2	96	0.097	0.125	6gejG.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
14	PDB:5y26B	0.474	0.611	2.732E-2	92	0.129	0.174	5y26B.pdb.gz
15	PDB:6t9iC	0.580	0.348	4.310E-2	214	0.169	0.098	6t9iC.pdb.gz
16	PDB:2rvqD	0.459	0.444	4.599E-2	129	0.129	0.124	2rvqD.pdb.gz
17	PDB:1jfiB	0.563	0.524	5.239E-2	135	0.121	0.111	1jfiB.pdb.gz	Crystal structure of negative cofactor 2 recognizing the TBP-DNA transcription complex.
18	PDB:5y27A	0.575	0.709	6.798E-2	98	0.089	0.112	5y27A.pdb.gz
19	PDB:2bykD	0.452	0.578	1.005E-1	92	0.089	0.120	2bykD.pdb.gz
20	PDB:7egdF	0.418	0.138	1.144E-1	412	0.121	0.036	7egdF.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P61216	7.07e-88	252	124	1.000	1.000	TAF13_MOUSE Transcription initiation factor TFIID subunit 13 OS=Mus musculus OX=10090 GN=Taf13 PE=1 SV=1
2	Q15543	7.07e-88	252	124	1.000	1.000	TAF13_HUMAN Transcription initiation factor TFIID subunit 13 OS=Homo sapiens OX=9606 GN=TAF13 PE=1 SV=1
3	Q9VIP1	6.03e-56	172	136	0.637	0.581	Q9VIP1_DROME GEO07843p1 OS=Drosophila melanogaster OX=7227 GN=Taf13 PE=1 SV=1
4	Q6NQH4	1.54e-35	120	126	0.468	0.460	TAF13_ARATH Transcription initiation factor TFIID subunit 13 OS=Arabidopsis thaliana OX=3702 GN=TAF13 PE=1 SV=1
5	O60076	1.96e-20	81.6	111	0.290	0.324	TAF13_SCHPO Transcription initiation factor TFIID subunit 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=taf13 PE=3 SV=3
6	P11747	5.15e-12	61.2	167	0.250	0.186	TAF13_YEAST Transcription initiation factor TFIID subunit 13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TAF13 PE=1 SV=2
7	B0QZW5	3.35e-07	49.7	382	0.226	0.073	B0QZW5_MOUSE SPT3, SAGA and STAGA complex component (Fragment) OS=Mus musculus OX=10090 GN=Supt3 PE=1 SV=1
8	O75486	3.46e-07	49.3	317	0.234	0.091	SUPT3_HUMAN Transcription initiation protein SPT3 homolog OS=Homo sapiens OX=9606 GN=SUPT3H PE=1 SV=3
9	Q8BWQ2	4.37e-07	49.3	374	0.226	0.075	Q8BWQ2_MOUSE Transcription initiation protein SPT3 homolog OS=Mus musculus OX=10090 GN=Supt3 PE=2 SV=1
10	Q8BVY4	4.50e-07	49.3	374	0.226	0.075	Q8BVY4_MOUSE SPT3, SAGA and STAGA complex component OS=Mus musculus OX=10090 GN=Supt3 PE=1 SV=1
11	Q8BU36	4.55e-07	49.3	374	0.226	0.075	Q8BU36_MOUSE Transcription initiation protein SPT3 homolog OS=Mus musculus OX=10090 GN=Supt3 PE=2 SV=1
12	O14311	6.18e-07	48.9	307	0.258	0.104	SPT3_SCHPO SAGA complex subunit spt3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=spt3 PE=1 SV=2
13	B0QZW4	7.22e-07	48.5	406	0.226	0.069	B0QZW4_MOUSE SPT3, SAGA and STAGA complex component (Fragment) OS=Mus musculus OX=10090 GN=Supt3 PE=1 SV=1
14	Q5BFG1	2.37e-06	47.0	331	0.194	0.073	Q5BFG1_EMENI SAGA-like transcriptional regulatory complex subunit Spt3, putative (AFU_orthologue AFUA_1G14030) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_00719 PE=4 SV=1
15	A0A1D8PU74	7.71e-06	45.4	328	0.226	0.085	A0A1D8PU74_CANAL Transcriptional regulator OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SPT3 PE=4 SV=1
16	P06844	2.49e-04	41.2	337	0.210	0.077	SPT3_YEAST Protein SPT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SPT3 PE=1 SV=1
17	A0A6I8PRV1	0.002	38.9	284	0.194	0.085	A0A6I8PRV1_HUMAN SPT3 homolog, SAGA and STAGA complex component (Fragment) OS=Homo sapiens OX=9606 GN=SUPT3H PE=1 SV=1
18	Q8I8U9	0.13	33.5	426	0.202	0.059	Q8I8U9_DROME Suppressor of Ty 3 OS=Drosophila melanogaster OX=7227 GN=Spt3 PE=2 SV=1
19	Q9VGE2	0.19	33.1	384	0.202	0.065	Q9VGE2_DROME FI01013p OS=Drosophila melanogaster OX=7227 GN=Spt3 PE=2 SV=1
20	Q6IWH7	3.0	29.6	933	0.202	0.027	ANO7_HUMAN Anoctamin-7 OS=Homo sapiens OX=9606 GN=ANO7 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03144 GTP_EFTU_D2	3.5e+02	13.0	Elongation factor Tu domain 2
2	PF02269 TFIID-18kDa	8.2e-35	130.0	Transcription initiation factor IID, 18kD subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1026970.XP_008848631.1

Rank	PPI partner	STRING score	Description
1	1026970.XP_008823343.1	0.999	TATA-box binding protein associated factor 3
2	1026970.XP_008838341.1	0.999	TATA-box binding protein associated factor 11
3	1026970.XP_008841626.1	0.999	TATA-box-binding protein
4	1026970.XP_008833725.1	0.998	TATA-box binding protein associated factor 7
5	1026970.XP_008821476.1	0.996	TATA-box binding protein associated factor 8
6	1026970.XP_008836201.1	0.996	TATA-box binding protein associated factor 2
7	1026970.XP_008837070.1	0.995	TATA-box binding protein associated factor 9
8	1026970.XP_008835639.1	0.994	TATA-box binding protein associated factor 10
9	1026970.XP_008841570.1	0.994	TATA-box binding protein associated factor 4
10	1026970.XP_008853785.1	0.994	TATA-box binding protein associated factor 1
11	1026970.XP_008843901.1	0.986	TATA-box binding protein associated factor 5
12	1026970.XP_008835881.1	0.980	TATA-box binding protein associated factor 9b
13	1026970.XP_008836859.1	0.974	Transcription initiation factor TFIID subunit 12-like isoform X1
14	1026970.XP_008846165.1	0.974	TATA-box binding protein associated factor 12
15	1026970.XP_008830613.1	0.973	TATA-box binding protein associated factor 6
16	1026970.XP_008837755.1	0.973	TATA box-binding protein-like protein 2
17	1026970.XP_008841710.1	0.973	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 11 mRNAs, 7 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments, including 4 samples with support for all annotated introns
18	1026970.XP_008843999.1	0.972	TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L
19	1026970.XP_008845860.1	0.971	TATA-box binding protein associated factor 4b
20	1026970.XP_008835096.1	0.961	Transcription initiation factor IIA subunit 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140223	0.999	general transcription initiation factor activity
GO:0003677	0.998	DNA binding
GO:0016251	0.977	RNA polymerase II general transcription initiation factor activity
GO:0008134	0.875	transcription factor binding
GO:0140296	0.855	general transcription initiation factor binding
GO:0017025	0.789	TBP-class protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006366	0.975	transcription by RNA polymerase II
GO:0045944	0.975	positive regulation of transcription by RNA polymerase II
GO:2000142	0.955	regulation of DNA-templated transcription initiation
GO:0016071	0.954	mRNA metabolic process
GO:0016043	0.953	cellular component organization
GO:0060260	0.953	regulation of transcription initiation by RNA polymerase II
GO:0006367	0.946	transcription initiation at RNA polymerase II promoter
GO:1901564	0.937	organonitrogen compound metabolic process
GO:0006793	0.925	phosphorus metabolic process
GO:0019538	0.924	protein metabolic process
GO:0060261	0.922	positive regulation of transcription initiation by RNA polymerase II
GO:0042789	0.920	mRNA transcription by RNA polymerase II
GO:0051123	0.918	RNA polymerase II preinitiation complex assembly
GO:0016310	0.917	phosphorylation
GO:0043412	0.896	macromolecule modification
GO:0036211	0.883	protein modification process
GO:0006468	0.867	protein phosphorylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031981	0.995	nuclear lumen
GO:0005654	0.994	nucleoplasm
GO:0043232	0.976	intracellular non-membrane-bounded organelle
GO:0032991	0.937	protein-containing complex
GO:1902494	0.859	catalytic complex
GO:0005730	0.578	nucleolus
GO:0140513	0.558	nuclear protein-containing complex
GO:0016591	0.487	RNA polymerase II, holoenzyme

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]