StarFunc result for job id Q15544

User Input

>input (211 residues)
MDDAHESPSDKGGETGESDETAAVPGDPGATDTDGIPEETDGDADVDLKEAAAEEGELES
QDVSDLTTVEREDSSLLNPAAKKLKIDTKEKKEKKQKVDEDEIQKMQILVSSFSEEQLNR
YEMYRRSAFPKAAIKRLIQSITGTSVSQNVVIAMSGISKVFVGEVVEEALDVCEKWGEMP
PLQPKHMREAVRRLKSKGQIPNSKHKKIIFF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15544	1.000	1.000	7.932E-31	211	1.000	1.000	Q15544.pdb.gz	TAF11_HUMAN Transcription initiation factor TFIID subunit 11 OS=Homo sapiens OX=9606 GN=TAF11 PE=1 SV=1
2	AFDB:Q99JX1	0.565	0.565	4.416E-27	211	0.867	0.867	Q99JX1.pdb.gz	TAF11_MOUSE Transcription initiation factor TFIID subunit 11 OS=Mus musculus OX=10090 GN=Taf11 PE=1 SV=1
3	AFDB:A0A3B3ITY8	0.342	0.358	3.181E-19	200	0.825	0.870	A0A3B3ITY8.pdb.gz	A0A3B3ITY8_HUMAN TATA-box binding protein associated factor 11 OS=Homo sapiens OX=9606 GN=TAF11 PE=1 SV=1
4	PDB:7edxk	0.439	0.917	2.673E-14	98	0.464	1.000	7edxk.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
5	AFDB:P49906	0.490	0.526	3.278E-14	196	0.412	0.444	P49906.pdb.gz	TAF11_DROME Transcription initiation factor TFIID subunit 11 OS=Drosophila melanogaster OX=7227 GN=Taf11 PE=1 SV=1
6	AFDB:Q9US54	0.479	0.506	3.849E-11	199	0.270	0.286	Q9US54.pdb.gz	TAF11_SCHPO Transcription initiation factor TFIID subunit 11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=taf11 PE=3 SV=1
7	AFDB:Q9M565	0.499	0.501	2.874E-10	210	0.256	0.257	Q9M565.pdb.gz	TAF11_ARATH Transcription initiation factor TFIID subunit 11 OS=Arabidopsis thaliana OX=3702 GN=TAF11 PE=1 SV=1
8	PDB:4draH	0.307	0.790	5.980E-3	76	0.071	0.197	4draH.pdb.gz
9	PDB:1bfmA	0.293	0.825	1.005E-2	69	0.071	0.217	1bfmA.pdb.gz
10	PDB:5z30G	0.304	0.537	1.072E-2	110	0.085	0.164	5z30G.pdb.gz	Cancer-associated mutations of histones H2B, H3.1 and H2A.Z.1 affect the structure and stability of the nucleosome.
11	PDB:6t9iE	0.294	0.146	1.220E-2	433	0.071	0.035	6t9iE.pdb.gz
12	PDB:5y27A	0.320	0.663	1.302E-2	98	0.062	0.133	5y27A.pdb.gz
13	PDB:1jfiB	0.315	0.481	1.688E-2	135	0.071	0.111	1jfiB.pdb.gz	Crystal structure of negative cofactor 2 recognizing the TBP-DNA transcription complex.
14	PDB:3b0bC	0.308	0.801	1.688E-2	75	0.071	0.200	3b0bC.pdb.gz
15	PDB:7egdF	0.314	0.168	1.921E-2	412	0.057	0.029	7egdF.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
16	PDB:1b67A	0.295	0.863	2.334E-2	68	0.066	0.206	1b67A.pdb.gz
17	AFDB:Q9FFA5	0.173	0.180	9.198E-2	202	0.180	0.188	Q9FFA5.pdb.gz	RMR14_ARATH Remorin 1.4 OS=Arabidopsis thaliana OX=3702 GN=REM1.4 PE=1 SV=1
18	AFDB:Q9M2D8	0.181	0.180	9.814E-2	212	0.209	0.208	Q9M2D8.pdb.gz	Y3126_ARATH Uncharacterized protein At3g61260 OS=Arabidopsis thaliana OX=3702 GN=At3g61260 PE=1 SV=1
19	AFDB:Q6NZ12	0.141	0.076	1.117E-1	500	0.142	0.060	Q6NZ12.pdb.gz
20	AFDB:Q70IK3	0.141	0.056	1.192E-1	669	0.137	0.043	Q70IK3.pdb.gz	Q70IK3_CHICK Helix-loop-helix protein E12 OS=Gallus gallus OX=9031 GN=TCF3 PE=2 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q15544	1.99e-154	427	211	1.000	1.000	TAF11_HUMAN Transcription initiation factor TFIID subunit 11 OS=Homo sapiens OX=9606 GN=TAF11 PE=1 SV=1
2	A0A3B3ITY8	1.51e-117	334	200	0.801	0.845	A0A3B3ITY8_HUMAN TATA-box binding protein associated factor 11 OS=Homo sapiens OX=9606 GN=TAF11 PE=1 SV=1
3	Q99JX1	1.58e-117	334	211	0.867	0.867	TAF11_MOUSE Transcription initiation factor TFIID subunit 11 OS=Mus musculus OX=10090 GN=Taf11 PE=1 SV=1
4	P49906	2.39e-49	161	196	0.355	0.383	TAF11_DROME Transcription initiation factor TFIID subunit 11 OS=Drosophila melanogaster OX=7227 GN=Taf11 PE=1 SV=1
5	Q9US54	1.59e-25	100	199	0.223	0.236	TAF11_SCHPO Transcription initiation factor TFIID subunit 11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=taf11 PE=3 SV=1
6	Q9M565	1.27e-21	90.1	210	0.204	0.205	TAF11_ARATH Transcription initiation factor TFIID subunit 11 OS=Arabidopsis thaliana OX=3702 GN=TAF11 PE=1 SV=1
7	Q04226	9.30e-12	65.1	346	0.118	0.072	TAF11_YEAST Transcription initiation factor TFIID subunit 11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TAF11 PE=1 SV=1
8	F4JAD2	0.65	33.1	468	0.166	0.075	F4JAD2_ARATH HXXXD-type acyl-transferase family protein OS=Arabidopsis thaliana OX=3702 GN=At3g47170 PE=4 SV=1
9	Q9NXL6	3.1	31.2	827	0.109	0.028	SIDT1_HUMAN SID1 transmembrane family member 1 OS=Homo sapiens OX=9606 GN=SIDT1 PE=2 SV=2
10	Q86XD5	4.2	30.4	332	0.047	0.030	F131B_HUMAN Protein FAM131B OS=Homo sapiens OX=9606 GN=FAM131B PE=1 SV=3
11	Q5A668	5.4	30.4	378	0.156	0.087	Q5A668_CANAL Ceramide very long chain fatty acid hydroxylase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SCS7 PE=3 SV=1
12	Q96CN5	6.1	30.4	670	0.100	0.031	LRC45_HUMAN Leucine-rich repeat-containing protein 45 OS=Homo sapiens OX=9606 GN=LRRC45 PE=1 SV=1
13	P19836	9.3	29.6	367	0.090	0.052	PCY1A_RAT Choline-phosphate cytidylyltransferase A OS=Rattus norvegicus OX=10116 GN=Pcyt1a PE=1 SV=2
14	A0A8I6ABF1	9.4	29.6	1286	0.052	0.009	A0A8I6ABF1_RAT TBC1 domain family, member 4 OS=Rattus norvegicus OX=10116 GN=Tbc1d4 PE=1 SV=1
15	A0A8I6AT49	10.0	29.6	1300	0.052	0.008	A0A8I6AT49_RAT TBC1 domain family, member 4 OS=Rattus norvegicus OX=10116 GN=Tbc1d4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00808 CBFD_NFYB_HMF	0.0085	27.7	Histone-like transcription factor (CBF/NF-Y) and archaeal histone
2	PF00125 Histone	83	14.9	Core histone H2A/H2B/H3/H4
3	PF04719 TAFII28	2.3e-35	131.8	hTAFII28-like protein conserved region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354633

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000252996	0.999	Transcription initiation factor TFIID subunit 4
2	9606.ENSP00000263974	0.999	Transcription initiation factor TFIID subunit 12
3	9606.ENSP00000299424	0.999	Transcription initiation factor TFIID subunit 10
4	9606.ENSP00000312709	0.999	Transcription initiation factor TFIID subunit 7
5	9606.ENSP00000340271	0.999	Transcription initiation factor TFIID subunit 3
6	9606.ENSP00000355051	0.999	Transcription initiation factor TFIID subunit 13
7	9606.ENSP00000358854	0.999	Transcription initiation factor TFIID subunit 5
8	9606.ENSP00000362068	0.999	Transcription initiation factor TFIID subunit 8
9	9606.ENSP00000367406	0.999	Transcription initiation factor TFIID subunit 2
10	9606.ENSP00000370193	0.999	Transcription initiation factor TFIID subunit 9
11	9606.ENSP00000375942	0.999	TATA-box-binding protein
12	9606.ENSP00000399982	0.999	Transcription initiation factor TFIID subunit 6
13	9606.ENSP00000406549	0.999	Transcription initiation factor TFIID subunit 1
14	9606.ENSP00000339917	0.998	Transcription initiation factor TFIID subunit 9B
15	9606.ENSP00000269142	0.996	Transcription initiation factor TFIID subunit 4B
16	9606.ENSP00000359531	0.985	Transcription initiation factor IIB
17	9606.ENSP00000418379	0.979	Transcription initiation factor TFIID subunit 1-like
18	9606.ENSP00000379372	0.968	Transcription initiation factor IIA subunit 2
19	9606.ENSP00000258281	0.967	TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L
20	9606.ENSP00000377969	0.958	General transcription factor IIF subunit 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016251	1.000	RNA polymerase II general transcription initiation factor activity
GO:0140297	0.995	DNA-binding transcription factor binding
GO:0003712	0.993	transcription coregulator activity
GO:0140296	0.992	general transcription initiation factor binding
GO:0042809	0.987	nuclear vitamin D receptor binding
GO:0003713	0.953	transcription coactivator activity
GO:0017025	0.950	TBP-class protein binding
GO:0046966	0.946	nuclear thyroid hormone receptor binding
GO:0003676	0.897	nucleic acid binding
GO:0003677	0.778	DNA binding
GO:0043565	0.379	sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006367	0.996	transcription initiation at RNA polymerase II promoter
GO:0065004	0.995	protein-DNA complex assembly
GO:0051252	0.995	regulation of RNA metabolic process
GO:0051123	0.994	RNA polymerase II preinitiation complex assembly
GO:0045944	0.989	positive regulation of transcription by RNA polymerase II
GO:0060260	0.987	regulation of transcription initiation by RNA polymerase II
GO:0060261	0.981	positive regulation of transcription initiation by RNA polymerase II
GO:0043412	0.961	macromolecule modification
GO:0036211	0.948	protein modification process
GO:0006796	0.724	phosphate-containing compound metabolic process
GO:0006468	0.589	protein phosphorylation
GO:0009299	0.586	mRNA transcription
GO:0042789	0.546	mRNA transcription by RNA polymerase II
GO:0044403	0.424	biological process involved in symbiotic interaction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005737	0.997	cytoplasm
GO:0032991	0.988	protein-containing complex
GO:1902494	0.971	catalytic complex
GO:0140535	0.962	intracellular protein-containing complex
GO:1990234	0.961	transferase complex
GO:0140513	0.958	nuclear protein-containing complex
GO:0016591	0.953	RNA polymerase II, holoenzyme
GO:0090575	0.951	RNA polymerase II transcription regulator complex
GO:0005669	0.944	transcription factor TFIID complex
GO:0012505	0.925	endomembrane system
GO:0005794	0.357	Golgi apparatus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]