StarFunc result for job id Q15545

User Input

>input (349 residues)
MSKSKDDAPHELESQFILRLPPEYASTVRRAVQSGHVNLKDRLTIELHPDGRHGIVRVDR
VPLASKLVDLPCVMESLKTIDKKTFYKTADICQMLVSTVDGDLYPPVEEPVASTDPKASK
KKDKDKEKKFIWNHGITLPLKNVRKRRFRKTAKKKYIESPDVEKEVKRLLSTDAEAVSTR
WEIIAEDETKEAENQGLDISSPGMSGHRQGHDSLEHDELREIFNDLSSSSEDEDETQHQD
EEDINIIDTEEDLERQLQDKLNESDEQHQENEGTNQLVMGIQKQIDNMKGKLQETQDRAK
RQEDLIMKVENLALKNRFQAVLDELKQKEDREKEQLSSLQEELESLLEK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15545	1.000	1.000	5.534E-59	349	1.000	1.000	Q15545.pdb.gz	TAF7_HUMAN Transcription initiation factor TFIID subunit 7 OS=Homo sapiens OX=9606 GN=TAF7 PE=1 SV=1
2	AFDB:Q5H9L4	0.416	0.319	2.208E-37	462	0.619	0.468	Q5H9L4.pdb.gz	TAF7L_HUMAN Transcription initiation factor TFIID subunit 7-like OS=Homo sapiens OX=9606 GN=TAF7L PE=1 SV=1
3	AFDB:Q9D3R9	0.390	0.293	1.581E-30	471	0.479	0.355	Q9D3R9.pdb.gz	TAF7L_MOUSE Transcription initiation factor TFIID subunit 7-like OS=Mus musculus OX=10090 GN=Taf7l PE=1 SV=2
4	PDB:7edxG	0.326	0.768	5.166E-24	145	0.413	0.993	7edxG.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
5	AFDB:O13701	0.320	0.285	2.694E-17	393	0.281	0.249	O13701.pdb.gz	TAF7_SCHPO Transcription initiation factor TFIID subunit 7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=taf7 PE=1 SV=1
6	AFDB:Q05021	0.328	0.201	3.677E-14	590	0.255	0.151	Q05021.pdb.gz	TAF7_YEAST Transcription initiation factor TFIID subunit 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TAF7 PE=1 SV=1
7	AFDB:Q9HB65	0.196	0.175	1.865E-6	397	0.138	0.121	Q9HB65.pdb.gz	ELL3_HUMAN RNA polymerase II elongation factor ELL3 OS=Homo sapiens OX=9606 GN=ELL3 PE=1 SV=2
8	AFDB:Q80VR2	0.197	0.177	8.607E-6	395	0.140	0.124	Q80VR2.pdb.gz	ELL3_MOUSE RNA polymerase II elongation factor ELL3 OS=Mus musculus OX=10090 GN=Ell3 PE=1 SV=1
9	AFDB:P38439	0.168	0.131	1.526E-4	464	0.143	0.108	P38439.pdb.gz	LEO1_YEAST RNA polymerase-associated protein LEO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LEO1 PE=1 SV=1
10	AFDB:F4IXI9	0.208	0.067	1.659E-3	1192	0.069	0.020	F4IXI9.pdb.gz	F4IXI9_ARATH Dentin sialophosphoprotein-like protein OS=Arabidopsis thaliana OX=3702 GN=MXL8.16 PE=1 SV=1
11	PDB:5msmB	0.155	0.365	8.751E-3	132	0.046	0.121	5msmB.pdb.gz	Structural studies of RFC(C)(tf18) reveal a novel chromatin recruitment role for Dcc1.
12	PDB:7edxT	0.193	0.511	1.428E-2	113	0.029	0.088	7edxT.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
13	AFDB:O14248	0.218	0.069	2.166E-2	1125	0.140	0.044	O14248.pdb.gz	TEA3_SCHPO Tip elongation aberrant protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tea3 PE=1 SV=1
14	PDB:3pufI	0.132	0.279	2.632E-2	140	0.037	0.093	3pufI.pdb.gz
15	PDB:6yj6C	0.146	0.153	2.975E-2	330	0.032	0.033	6yj6C.pdb.gz
16	PDB:6o9lT	0.182	0.253	3.162E-2	237	0.072	0.105	6o9lT.pdb.gz	Transcription preinitiation complex structure and dynamics provide insight into genetic diseases.
17	PDB:7d58N	0.129	0.274	3.574E-2	136	0.052	0.132	7d58N.pdb.gz	Structural insights into transcriptional regulation of human RNA polymerase III.
18	PDB:7dn3N	0.166	0.516	4.853E-2	92	0.037	0.141	7dn3N.pdb.gz	Structure of human RNA polymerase III elongation complex.
19	PDB:6s1cB	0.153	0.156	5.159E-2	342	0.043	0.044	6s1cB.pdb.gz	Ctf18-RFC and DNA Pol ε form a stable leading strand polymerase/clamp loader complex required for normal and perturbed DNA replication.
20	PDB:6s1cF	0.153	0.176	5.484E-2	299	0.043	0.050	6s1cF.pdb.gz	Ctf18-RFC and DNA Pol ε form a stable leading strand polymerase/clamp loader complex required for normal and perturbed DNA replication.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q15545	0.0	707	349	1.000	1.000	TAF7_HUMAN Transcription initiation factor TFIID subunit 7 OS=Homo sapiens OX=9606 GN=TAF7 PE=1 SV=1
2	Q6R1L1	0.0	673	341	0.954	0.977	TAF7_CRIGR Transcription initiation factor TFIID subunit 7 OS=Cricetulus griseus OX=10029 GN=TAF7 PE=1 SV=1
3	Q9R1C0	0.0	600	341	0.883	0.903	TAF7_MOUSE Transcription initiation factor TFIID subunit 7 OS=Mus musculus OX=10090 GN=Taf7 PE=1 SV=1
4	Q5H9L4	1.15e-123	365	462	0.605	0.457	TAF7L_HUMAN Transcription initiation factor TFIID subunit 7-like OS=Homo sapiens OX=9606 GN=TAF7L PE=1 SV=1
5	Q9D3R9	2.09e-83	262	471	0.458	0.340	TAF7L_MOUSE Transcription initiation factor TFIID subunit 7-like OS=Mus musculus OX=10090 GN=Taf7l PE=1 SV=2
6	O13701	7.61e-28	114	393	0.218	0.193	TAF7_SCHPO Transcription initiation factor TFIID subunit 7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=taf7 PE=1 SV=1
7	Q05021	1.31e-10	64.7	590	0.169	0.100	TAF7_YEAST Transcription initiation factor TFIID subunit 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TAF7 PE=1 SV=1
8	P24043	0.045	38.5	3122	0.092	0.010	LAMA2_HUMAN Laminin subunit alpha-2 OS=Homo sapiens OX=9606 GN=LAMA2 PE=1 SV=4
9	Q8I3S3	0.15	36.6	1894	0.086	0.016	Q8I3S3_PLAF7 mRNA-binding protein PUF1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0518700 PE=4 SV=1
10	Q18823	0.29	35.8	1633	0.166	0.036	LAM2_CAEEL Laminin-like protein lam-2 OS=Caenorhabditis elegans OX=6239 GN=lam-2 PE=1 SV=3
11	Q5HZI1	1.0	33.9	1210	0.135	0.039	MTUS1_MOUSE Microtubule-associated tumor suppressor 1 homolog OS=Mus musculus OX=10090 GN=Mtus1 PE=1 SV=2
12	P11046	1.5	33.5	1788	0.115	0.022	LAMB1_DROME Laminin subunit beta-1 OS=Drosophila melanogaster OX=7227 GN=LanB1 PE=1 SV=4
13	Q6IMY1	2.3	32.7	440	0.135	0.107	MTUS1_RAT Microtubule-associated tumor suppressor 1 homolog OS=Rattus norvegicus OX=10116 GN=Mtus1 PE=1 SV=1
14	Q9Y102	6.4	31.2	800	0.095	0.041	Q9Y102_DROME BcDNA.GH11973 OS=Drosophila melanogaster OX=7227 GN=rgn PE=1 SV=1
15	M9PFV8	7.6	31.2	808	0.095	0.041	M9PFV8_DROME Regeneration, isoform B OS=Drosophila melanogaster OX=7227 GN=rgn PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04658 TAFII55_N	3.1e-56	201.1	TAFII55 protein conserved region
2	PF04906 Tweety	6.5e+02	10.4	Tweety

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000312709

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000252996	0.999	Transcription initiation factor TFIID subunit 4
2	9606.ENSP00000263974	0.999	Transcription initiation factor TFIID subunit 12
3	9606.ENSP00000299424	0.999	Transcription initiation factor TFIID subunit 10
4	9606.ENSP00000339917	0.999	Transcription initiation factor TFIID subunit 9B
5	9606.ENSP00000340271	0.999	Transcription initiation factor TFIID subunit 3
6	9606.ENSP00000354633	0.999	Transcription initiation factor TFIID subunit 11
7	9606.ENSP00000355051	0.999	Transcription initiation factor TFIID subunit 13
8	9606.ENSP00000358854	0.999	Transcription initiation factor TFIID subunit 5
9	9606.ENSP00000362068	0.999	Transcription initiation factor TFIID subunit 8
10	9606.ENSP00000367406	0.999	Transcription initiation factor TFIID subunit 2
11	9606.ENSP00000370193	0.999	Transcription initiation factor TFIID subunit 9
12	9606.ENSP00000375942	0.999	TATA-box-binding protein
13	9606.ENSP00000399982	0.999	Transcription initiation factor TFIID subunit 6
14	9606.ENSP00000406549	0.999	Transcription initiation factor TFIID subunit 1
15	9606.ENSP00000418379	0.999	Transcription initiation factor TFIID subunit 1-like
16	9606.ENSP00000258281	0.992	TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L
17	9606.ENSP00000269142	0.990	Transcription initiation factor TFIID subunit 4B
18	9606.ENSP00000379372	0.985	Transcription initiation factor IIA subunit 2
19	9606.ENSP00000452454	0.985	Transcription initiation factor IIA subunit 1
20	9606.ENSP00000294168	0.981	TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0035035	1.000	histone acetyltransferase binding
GO:0003676	0.993	nucleic acid binding
GO:0008134	0.988	transcription factor binding
GO:0003677	0.981	DNA binding
GO:0140223	0.979	general transcription initiation factor activity
GO:0140297	0.975	DNA-binding transcription factor binding
GO:0061629	0.963	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0140296	0.961	general transcription initiation factor binding
GO:0016251	0.954	RNA polymerase II general transcription initiation factor activity
GO:0001099	0.953	basal RNA polymerase II transcription machinery binding
GO:0016922	0.942	nuclear receptor binding
GO:0042393	0.937	histone binding
GO:1990837	0.936	sequence-specific double-stranded DNA binding
GO:0140030	0.932	modification-dependent protein binding
GO:0000976	0.932	transcription cis-regulatory region binding
GO:0001091	0.928	RNA polymerase II general transcription initiation factor binding
GO:0046966	0.922	nuclear thyroid hormone receptor binding
GO:0046982	0.921	protein heterodimerization activity
GO:0035064	0.921	methylated histone binding
GO:0044877	0.899	protein-containing complex binding
GO:0106140	0.879	P-TEFb complex binding
GO:0061628	0.879	H3K27me3 modified histone binding
GO:0042809	0.878	nuclear vitamin D receptor binding
GO:0001097	0.878	TFIIH-class transcription factor complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0071704	0.987	organic substance metabolic process
GO:0044238	0.987	primary metabolic process
GO:0006807	0.985	nitrogen compound metabolic process
GO:0043170	0.984	macromolecule metabolic process
GO:0044237	0.982	cellular metabolic process
GO:0050794	0.978	regulation of cellular process
GO:0080090	0.968	regulation of primary metabolic process
GO:0051171	0.968	regulation of nitrogen compound metabolic process
GO:0031323	0.968	regulation of cellular metabolic process
GO:0010468	0.968	regulation of gene expression
GO:0006351	0.967	DNA-templated transcription
GO:0006366	0.963	transcription by RNA polymerase II
GO:0006355	0.956	regulation of DNA-templated transcription
GO:0016570	0.924	histone modification
GO:0018205	0.921	peptidyl-lysine modification
GO:0043543	0.919	protein acylation
GO:0006473	0.913	protein acetylation
GO:0016573	0.899	histone acetylation
GO:0006357	0.897	regulation of transcription by RNA polymerase II
GO:0006367	0.849	transcription initiation at RNA polymerase II promoter
GO:0071840	0.843	cellular component organization or biogenesis
GO:2000142	0.840	regulation of DNA-templated transcription initiation
GO:0009299	0.838	mRNA transcription
GO:0065004	0.834	protein-DNA complex assembly
GO:0048518	0.819	positive regulation of biological process
GO:0060260	0.814	regulation of transcription initiation by RNA polymerase II
GO:0070897	0.797	transcription preinitiation complex assembly
GO:0048519	0.791	negative regulation of biological process
GO:0070647	0.784	protein modification by small protein conjugation or removal
GO:2000144	0.783	positive regulation of DNA-templated transcription initiation
GO:0042789	0.772	mRNA transcription by RNA polymerase II
GO:0051123	0.771	RNA polymerase II preinitiation complex assembly
GO:0070646	0.760	protein modification by small protein removal
GO:0016579	0.752	protein deubiquitination
GO:0031399	0.720	regulation of protein modification process
GO:0045944	0.702	positive regulation of transcription by RNA polymerase II
GO:0051234	0.679	establishment of localization
GO:0006810	0.674	transport
GO:0015846	0.662	polyamine transport
GO:0050896	0.647	response to stimulus
GO:0009892	0.612	negative regulation of metabolic process
GO:0065009	0.603	regulation of molecular function
GO:0010605	0.560	negative regulation of macromolecule metabolic process
GO:0051172	0.557	negative regulation of nitrogen compound metabolic process
GO:0048523	0.527	negative regulation of cellular process
GO:0051174	0.472	regulation of phosphorus metabolic process
GO:0051716	0.434	cellular response to stimulus
GO:0051338	0.387	regulation of transferase activity
GO:0031324	0.387	negative regulation of cellular metabolic process
GO:1901983	0.382	regulation of protein acetylation
GO:0060261	0.364	positive regulation of transcription initiation by RNA polymerase II
GO:0007154	0.357	cell communication
GO:0007165	0.348	signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005669	1.000	transcription factor TFIID complex
GO:0043232	0.995	intracellular non-membrane-bounded organelle
GO:0005737	0.987	cytoplasm
GO:0000785	0.961	chromatin
GO:0000123	0.935	histone acetyltransferase complex
GO:0071339	0.935	MLL1 complex
GO:0070461	0.897	SAGA-type complex
GO:0033276	0.387	transcription factor TFTC complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]