StarFunc result for job id Q15546

User Input

>input (238 residues)
MRFKNRFQRFMNHRAPANGRYKPTCYEHAANCYTHAFLIVPAIVGSALLHRLSDDCWEKI
TAWIYGMGLCALFIVSTVFHIVSWKKSHLRTVEHCFHMCDRMVIYFFIAASYAPWLNLRE
LGPLASHMRWFIWLMAAGGTIYVFLYHEKYKVVELFFYLTMGFSPALVVTSMNNTDGLQE
LACGGLIYCLGVVFFKSDGIIPFAHAIWHLFVATAAAVHYYAIWKYLYRSPTDFMRHL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15546	1.000	1.000	7.209E-34	238	1.000	1.000	Q15546.pdb.gz	PAQRB_HUMAN Monocyte to macrophage differentiation factor OS=Homo sapiens OX=9606 GN=MMD PE=1 SV=2
2	AFDB:D3YLD5	0.974	0.970	3.463E-27	239	0.803	0.799	D3YLD5.pdb.gz
3	AFDB:D3YLD4	0.957	0.938	7.141E-23	243	0.647	0.634	D3YLD4.pdb.gz	D3YLD4_DANRE Monocyte to macrophage differentiation factor 2 OS=Danio rerio OX=7955 GN=mmd2 PE=2 SV=1
4	AFDB:Q8IY49	0.929	0.821	1.015E-22	270	0.685	0.604	Q8IY49.pdb.gz	PAQRA_HUMAN Monocyte to macrophage differentiation factor 2 OS=Homo sapiens OX=9606 GN=MMD2 PE=1 SV=2
5	AFDB:A8KB92	0.506	0.460	2.887E-11	263	0.437	0.395	A8KB92.pdb.gz
6	AFDB:P67153	0.809	0.877	7.145E-10	219	0.273	0.297	P67153.pdb.gz	YQFA_ECOLI UPF0073 inner membrane protein YqfA OS=Escherichia coli (strain K12) OX=83333 GN=yqfA PE=1 SV=1
7	AFDB:Q38A44	0.756	0.596	2.073E-7	307	0.235	0.182	Q38A44.pdb.gz	Q38A44_TRYB2 Adiponectin receptor protein 1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.1100 PE=4 SV=1
8	AFDB:Q9N536	0.710	0.309	7.293E-6	581	0.193	0.079	Q9N536.pdb.gz	Q9N536_CAEEL Adiponectin receptor protein OS=Caenorhabditis elegans OX=6239 GN=paqr-2 PE=1 SV=2
9	AFDB:Q38A43	0.708	0.494	1.540E-5	349	0.189	0.129	Q38A43.pdb.gz	Q38A43_TRYB2 Adiponectin receptor protein 1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.1090 PE=4 SV=1
10	AFDB:Q9VCY8	0.705	0.397	1.836E-5	444	0.176	0.095	Q9VCY8.pdb.gz	ADRL_DROME Adiponectin receptor protein OS=Drosophila melanogaster OX=7227 GN=AdipoR PE=1 SV=2
11	PDB:6g7oA	0.587	0.422	1.900E-3	350	0.160	0.109	6g7oA.pdb.gz	Structure of a human intramembrane ceramidase explains enzymatic dysfunction found in leukodystrophy.
12	PDB:7wicR	0.495	0.426	2.432E-2	288	0.092	0.076	7wicR.pdb.gz	Structures of the endogenous peptide- and selective non-peptide agonist-bound SSTR2 signaling complexes.
13	PDB:7durR	0.338	0.254	2.656E-2	371	0.113	0.073	7durR.pdb.gz	Molecular insights into ago-allosteric modulation of the human glucagon-like peptide-1 receptor.
14	PDB:4k5yC	0.434	0.423	5.135E-2	248	0.113	0.109	4k5yC.pdb.gz	Structure of class B GPCR corticotropin-releasing factor receptor 1.
15	PDB:7xtcR	0.444	0.401	5.607E-2	275	0.126	0.109	7xtcR.pdb.gz	GPCRs steer G i and G s selectivity via TM5-TM6 switches as revealed by structures of serotonin receptors.
16	PDB:7lciR	0.463	0.322	6.398E-2	393	0.147	0.089	7lciR.pdb.gz	Evolving cryo-EM structural approaches for GPCR drug discovery.
17	PDB:7yu4A	0.512	0.470	7.299E-2	266	0.113	0.102	7yu4A.pdb.gz	Structure of the active G i -coupled human lysophosphatidic acid receptor 1 complexed with a potent agonist.
18	PDB:7r0cA	0.424	0.377	8.703E-2	284	0.101	0.085	7r0cA.pdb.gz	Structure of the vasopressin hormone-V2 receptor-beta-arrestin1 ternary complex.
19	PDB:6vn7R	0.467	0.437	9.094E-2	263	0.097	0.087	6vn7R.pdb.gz	Cryo-EM structure of an activated VIP1 receptor-G protein complex revealed by a NanoBiT tethering strategy.
20	PDB:7d3sR	0.401	0.375	9.094E-2	266	0.080	0.071	7d3sR.pdb.gz	Structure of the human secretin receptor coupled to an engineered heterotrimeric G protein.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q15546	3.44e-180	495	238	1.000	1.000	PAQRB_HUMAN Monocyte to macrophage differentiation factor OS=Homo sapiens OX=9606 GN=MMD PE=1 SV=2
2	Q32LT2	2.65e-142	399	239	0.790	0.787	Q32LT2_DANRE Monocyte to macrophage differentiation factor OS=Danio rerio OX=7955 GN=zgc:123296 PE=2 SV=1
3	Q8IY49	8.25e-118	338	270	0.693	0.611	PAQRA_HUMAN Monocyte to macrophage differentiation factor 2 OS=Homo sapiens OX=9606 GN=MMD2 PE=1 SV=2
4	D3YLD4	2.80e-117	336	243	0.647	0.634	D3YLD4_DANRE Monocyte to macrophage differentiation factor 2 OS=Danio rerio OX=7955 GN=mmd2 PE=2 SV=1
5	P67153	3.87e-23	95.1	219	0.282	0.306	YQFA_ECOLI UPF0073 inner membrane protein YqfA OS=Escherichia coli (strain K12) OX=83333 GN=yqfA PE=1 SV=1
6	Q38A44	0.17	35.0	307	0.227	0.176	Q38A44_TRYB2 Adiponectin receptor protein 1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.1100 PE=4 SV=1
7	P38359	1.3	32.7	859	0.092	0.026	SUL1_YEAST Sulfate permease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUL1 PE=1 SV=2
8	Q12325	1.6	32.3	893	0.071	0.019	SUL2_YEAST Sulfate permease 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUL2 PE=1 SV=1
9	Q6ZS10	3.5	31.2	378	0.071	0.045	CL17A_HUMAN C-type lectin domain family 17, member A OS=Homo sapiens OX=9606 GN=CLEC17A PE=1 SV=2
10	Q9ZVR7	7.7	30.4	1008	0.084	0.020	PSKR1_ARATH Phytosulfokine receptor 1 OS=Arabidopsis thaliana OX=3702 GN=PSKR1 PE=1 SV=4
11	Q06182	7.8	29.6	252	0.063	0.060	SWI10_SCHPO Mating-type switching protein swi10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=swi10 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03006 HlyIII	1.4e-14	65.9	Haemolysin-III related

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000001869

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000005297	0.734	Adenosine kinase
2	60711.ENSCSAP00000011543	0.700	SPO11, initiator of meiotic double stranded breaks
3	60711.ENSCSAP00000018663	0.661	Taste receptor, type 2, member 38
4	60711.ENSCSAP00000007942	0.656	acyl-CoA wax alcohol acyltransferase 2
5	60711.ENSCSAP00000000413	0.649	B-cell scaffold protein with ankyrin repeats 1
6	60711.ENSCSAP00000009049	0.567	Calbindin 1, 28kDa
7	60711.ENSCSAP00000001833	0.550	Belongs to the alpha-carbonic anhydrase family.
8	60711.ENSCSAP00000014856	0.534	Uncharacterized protein
9	60711.ENSCSAP00000018785	0.521	Somatostatin receptor 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0038023	1.000	signaling receptor activity
GO:0005515	1.000	protein binding
GO:0004672	1.000	protein kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0050794	0.994	regulation of cellular process
GO:0065009	0.979	regulation of molecular function
GO:0051174	0.971	regulation of phosphorus metabolic process
GO:0051246	0.971	regulation of protein metabolic process
GO:0051338	0.961	regulation of transferase activity
GO:0001932	0.936	regulation of protein phosphorylation
GO:0045859	0.910	regulation of protein kinase activity
GO:0048518	0.861	positive regulation of biological process
GO:0048522	0.810	positive regulation of cellular process
GO:0009987	0.711	cellular process
GO:0010604	0.586	positive regulation of macromolecule metabolic process
GO:0045664	0.545	regulation of neuron differentiation
GO:0051247	0.510	positive regulation of protein metabolic process
GO:0031401	0.438	positive regulation of protein modification process
GO:0045666	0.427	positive regulation of neuron differentiation
GO:0001934	0.412	positive regulation of protein phosphorylation
GO:0048583	0.405	regulation of response to stimulus
GO:0033674	0.403	positive regulation of kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005794	1.000	Golgi apparatus
GO:0005886	0.998	plasma membrane
GO:0031090	0.592	organelle membrane
GO:0098588	0.401	bounding membrane of organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]