StarFunc result for job id Q15554

User Input

>input (542 residues)
MAAGAGTAGPASGPGVVRDPAASQPRKRPGREGGEGARRSDTMAGGGGSSDGSGRAAGRR
ASRSSGRARRGRHEPGLGGPAERGAGEARLEEAVNRWVLKFYFHEALRAFRGSRYGDFRQ
IRDIMQALLVRPLGKEHTVSRLLRVMQCLSRIEEGENLDCSFDMEAELTPLESAINVLEM
IKTEFTLTEAVVESSRKLVKEAAVIICIKNKEFEKASKILKKHMSKDPTTQKLRNDLLNI
IREKNLAHPVIQNFSYETFQQKMLRFLESHLDDAEPYLLTMAKKALKSESAASSTGKEDK
QPAPGPVEKPPREPARQLRNPPTTIGMMTLKAAFKTLSGAQDSEAAFAKLDQKDLVLPTQ
ALPASPALKNKRPRKDENESSAPADGEGGSELQPKNKRMTISRLVLEEDSQSTEPSAGLN
SSQEAASAPPSKPTVLNQPLPGEKNPKVPKGKWNSSNGVEEKETWVEEDELFQVQAAPDE
DSTTNITKKQKWTVEESEWVKAGVQKYGEGNWAAISKNYPFVNRTAVMIKDRWRTMKRLG
MN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15554	1.000	1.000	8.046E-62	542	1.000	1.000	Q15554.pdb.gz	TERF2_HUMAN Telomeric repeat-binding factor 2 OS=Homo sapiens OX=9606 GN=TERF2 PE=1 SV=3
2	AFDB:O35144	0.478	0.479	1.008E-51	541	0.851	0.852	O35144.pdb.gz	TERF2_MOUSE Telomeric repeat-binding factor 2 OS=Mus musculus OX=10090 GN=Terf2 PE=1 SV=3
3	AFDB:B1H237	0.485	0.557	2.459E-41	466	0.718	0.835	B1H237.pdb.gz	B1H237_RAT Terf2 protein OS=Rattus norvegicus OX=10116 GN=Terf2 PE=2 SV=1
4	AFDB:P54274	0.363	0.442	1.645E-14	439	0.218	0.269	P54274.pdb.gz	TERF1_HUMAN Telomeric repeat-binding factor 1 OS=Homo sapiens OX=9606 GN=TERF1 PE=1 SV=3
5	AFDB:Q5EB98	0.373	0.470	1.879E-14	421	0.229	0.295	Q5EB98.pdb.gz
6	AFDB:P70371	0.375	0.475	1.159E-13	421	0.220	0.283	P70371.pdb.gz	TERF1_MOUSE Telomeric repeat-binding factor 1 OS=Mus musculus OX=10090 GN=Terf1 PE=1 SV=1
7	AFDB:Q0JRZ9	0.065	0.046	2.599E-2	810	0.138	0.093	Q0JRZ9.pdb.gz	FCHO2_HUMAN F-BAR domain only protein 2 OS=Homo sapiens OX=9606 GN=FCHO2 PE=1 SV=2
8	AFDB:A0A1D8PRB9	0.105	0.066	3.245E-2	1045	0.118	0.061	A0A1D8PRB9.pdb.gz	A0A1D8PRB9_CANAL Arf family guanine nucleotide exchange factor OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C703480WA PE=4 SV=1
9	AFDB:Q304E5	0.141	0.109	5.286E-2	771	0.105	0.074	Q304E5.pdb.gz	Q304E5_CAEEL Guanyl-specific ribonuclease pgl-1 OS=Caenorhabditis elegans OX=6239 GN=pgl-1 PE=1 SV=1
10	AFDB:Q23670	0.073	0.036	9.004E-2	1520	0.116	0.041	Q23670.pdb.gz	TOP2_CAEEL DNA topoisomerase 2 top-2 OS=Caenorhabditis elegans OX=6239 GN=top-2 PE=1 SV=2
11	PDB:3zc0B	0.141	0.336	2.065E-1	191	0.035	0.099	3zc0B.pdb.gz	Structural Basis for Duplex RNA Recognition and Cleavage by Archaeoglobus Fulgidus C3Po.
12	PDB:5njxA	0.178	0.222	3.365E-1	413	0.037	0.048	5njxA.pdb.gz	Combined x-ray crystallography and computational modeling approach to investigate the Hsp90 C-terminal peptide binding to FKBP51.
13	PDB:3szrA	0.094	0.092	4.798E-1	559	0.050	0.048	3szrA.pdb.gz
14	PDB:3mv2B	0.098	0.154	5.016E-1	293	0.055	0.102	3mv2B.pdb.gz
15	PDB:6q8fA	0.125	0.286	5.016E-1	197	0.052	0.142	6q8fA.pdb.gz
16	PDB:1qoyA	0.083	0.126	5.482E-1	303	0.059	0.106	1qoyA.pdb.gz
17	PDB:5a1vK	0.131	0.071	9.336E-1	1126	0.044	0.021	5a1vK.pdb.gz
18	PDB:5gtmB	0.099	0.102	9.336E-1	522	0.052	0.054	5gtmB.pdb.gz
19	PDB:7ajuUL	0.109	0.083	9.760E-1	779	0.044	0.031	7ajuUL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
20	PDB:4nrhB	0.149	0.363	1.020	170	0.037	0.118	4nrhB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6A085	0.0	524	318	0.518	0.884	A0A8I6A085_RAT Telomeric repeat binding factor 2 OS=Rattus norvegicus OX=10116 GN=Terf2 PE=1 SV=1
2	B1H237	0.0	701	466	0.694	0.807	B1H237_RAT Terf2 protein OS=Rattus norvegicus OX=10116 GN=Terf2 PE=2 SV=1
3	D3ZJF7	0.0	855	536	0.825	0.834	D3ZJF7_RAT Telomeric repeat-binding factor OS=Rattus norvegicus OX=10116 GN=Terf2 PE=1 SV=3
4	F6KWE7	0.0	526	320	0.520	0.881	F6KWE7_RAT Telomeric repeat binding factor 2 isoform OS=Rattus norvegicus OX=10116 GN=Terf2 PE=2 SV=1
5	H3BR06	0.0	567	283	0.513	0.982	H3BR06_HUMAN Telomeric repeat binding factor 2 (Fragment) OS=Homo sapiens OX=9606 GN=TERF2 PE=1 SV=1
6	O35144	0.0	819	541	0.823	0.824	TERF2_MOUSE Telomeric repeat-binding factor 2 OS=Mus musculus OX=10090 GN=Terf2 PE=1 SV=3
7	Q15554	0.0	1109	542	1.000	1.000	TERF2_HUMAN Telomeric repeat-binding factor 2 OS=Homo sapiens OX=9606 GN=TERF2 PE=1 SV=3
8	U3KQ35	1.15e-152	438	244	0.406	0.902	U3KQ35_HUMAN Telomeric repeat binding factor 2 (Fragment) OS=Homo sapiens OX=9606 GN=TERF2 PE=1 SV=1
9	Q9PU53	7.95e-81	269	718	0.229	0.173	TERF2_CHICK Telomeric repeat-binding factor 2 OS=Gallus gallus OX=9031 GN=TERF2 PE=1 SV=2
10	J3KSZ6	1.39e-76	240	144	0.221	0.833	J3KSZ6_HUMAN Telomeric repeat binding factor 2 (Fragment) OS=Homo sapiens OX=9606 GN=TERF2 PE=1 SV=1
11	P70371	7.90e-21	97.1	421	0.120	0.154	TERF1_MOUSE Telomeric repeat-binding factor 1 OS=Mus musculus OX=10090 GN=Terf1 PE=1 SV=1
12	P54274	2.18e-19	93.2	439	0.111	0.137	TERF1_HUMAN Telomeric repeat-binding factor 1 OS=Homo sapiens OX=9606 GN=TERF1 PE=1 SV=3
13	Q7T1R9	1.94e-16	83.2	345	0.116	0.183	Q7T1R9_CHICK TTAGGG repeat binding factor 1 (Fragment) OS=Gallus gallus OX=9031 GN=TERF1 PE=2 SV=1
14	A0A8I5Y1U3	1.32e-15	80.9	392	0.066	0.092	A0A8I5Y1U3_RAT Telomeric repeat-binding factor OS=Rattus norvegicus OX=10116 GN=Terf1 PE=4 SV=1
15	Q6T804	6.48e-07	54.3	426	0.044	0.056	Q6T804_ORYSJ ANTHER INDEHISCENCE1 OS=Oryza sativa subsp. japonica OX=39947 GN=AID1 PE=2 SV=1
16	F4I7K3	1.96e-05	49.7	624	0.044	0.038	F4I7K3_ARATH TRF-like 3 OS=Arabidopsis thaliana OX=3702 GN=TRFL3 PE=1 SV=1
17	F4IEY4	1.04e-04	46.6	287	0.037	0.070	TRB5_ARATH Telomere repeat-binding factor 5 OS=Arabidopsis thaliana OX=3702 GN=At1g72740 PE=2 SV=1
18	Q8VWK4	1.66e-04	46.2	300	0.044	0.080	TRB1_ARATH Telomere repeat-binding factor 1 OS=Arabidopsis thaliana OX=3702 GN=TRB1 PE=1 SV=1
19	Q8GZ96	2.10e-04	46.6	834	0.039	0.025	Q8GZ96_ARATH At1g58220 OS=Arabidopsis thaliana OX=3702 GN=DRMY1 PE=1 SV=1
20	Q6WS85	4.65e-04	44.7	299	0.041	0.074	SMH1_MAIZE Single myb histone 1 OS=Zea mays OX=4577 GN=SMH1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00249 Myb_DNA-binding	4.4e-09	47.7	Myb-like DNA-binding domain
2	PF13921 Myb_DNA-bind_6	0.04	25.5	Myb-like DNA-binding domain
3	PF01399 PCI	55	15.7	PCI domain
4	PF16772 TERF2_RBM	8.1e-14	62.1	Telomeric repeat-binding factor 2 Rap1-binding motif
5	PF08558 TRF	2.5e-32	124.0	Telomere repeat binding factor (TRF)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000254942

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000267415	0.999	TERF1-interacting nuclear factor 2
2	9606.ENSP00000300086	0.999	Telomeric repeat-binding factor 2-interacting protein 1
3	9606.ENSP00000358576	0.999	5' exonuclease Apollo
4	9606.ENSP00000265433	0.997	Nibrin
5	9606.ENSP00000350249	0.997	Protection of telomeres protein 1
6	9606.ENSP00000325863	0.992	Double-strand break repair protein MRE11
7	9606.ENSP00000294008	0.991	Structure-specific endonuclease subunit SLX4
8	9606.ENSP00000483117	0.990	Adrenocortical dysplasia protein homolog
9	9606.ENSP00000368100	0.987	DNA repair protein RAD50
10	9606.ENSP00000352257	0.983	X-ray repair cross-complementing protein 6
11	9606.ENSP00000347232	0.980	Bloom syndrome protein
12	9606.ENSP00000298139	0.978	Werner syndrome ATP-dependent helicase
13	9606.ENSP00000276603	0.964	Telomeric repeat-binding factor 1
14	9606.ENSP00000278616	0.962	Serine-protein kinase ATM
15	9606.ENSP00000305480	0.960	Flap endonuclease 1
16	9606.ENSP00000250416	0.943	Poly [ADP-ribose] polymerase 2
17	9606.ENSP00000266970	0.942	Cyclin-dependent kinase 2
18	9606.ENSP00000313759	0.940	CST complex subunit CTC1
19	9606.ENSP00000274026	0.908	Cyclin-A2
20	9606.ENSP00000434024	0.908	Histone H2AX

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044877	1.000	protein-containing complex binding
GO:0042803	1.000	protein homodimerization activity
GO:0003691	1.000	double-stranded telomeric DNA binding
GO:0003824	0.989	catalytic activity
GO:0003697	0.988	single-stranded DNA binding
GO:0098847	0.976	sequence-specific single stranded DNA binding
GO:0140097	0.974	catalytic activity, acting on DNA
GO:0043047	0.972	single-stranded telomeric DNA binding
GO:0003964	0.929	RNA-directed DNA polymerase activity
GO:0003720	0.906	telomerase activity
GO:0019899	0.835	enzyme binding
GO:0098505	0.686	G-rich strand telomeric DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0080090	0.988	regulation of primary metabolic process
GO:0051171	0.988	regulation of nitrogen compound metabolic process
GO:0060255	0.987	regulation of macromolecule metabolic process
GO:0031323	0.987	regulation of cellular metabolic process
GO:0016043	0.986	cellular component organization
GO:0006259	0.986	DNA metabolic process
GO:0051052	0.979	regulation of DNA metabolic process
GO:0000723	0.979	telomere maintenance
GO:0051641	0.976	cellular localization
GO:0048523	0.975	negative regulation of cellular process
GO:0045934	0.973	negative regulation of nucleobase-containing compound metabolic process
GO:0010605	0.970	negative regulation of macromolecule metabolic process
GO:0033043	0.969	regulation of organelle organization
GO:0051053	0.957	negative regulation of DNA metabolic process
GO:0032204	0.955	regulation of telomere maintenance
GO:0016233	0.938	telomere capping
GO:0048518	0.937	positive regulation of biological process
GO:0048522	0.927	positive regulation of cellular process
GO:2001251	0.917	negative regulation of chromosome organization
GO:0010604	0.899	positive regulation of macromolecule metabolic process
GO:0045935	0.899	positive regulation of nucleobase-containing compound metabolic process
GO:0006974	0.853	cellular response to DNA damage stimulus
GO:0051054	0.809	positive regulation of DNA metabolic process
GO:0065009	0.767	regulation of molecular function
GO:2001252	0.689	positive regulation of chromosome organization
GO:0050790	0.686	regulation of catalytic activity
GO:0010556	0.615	regulation of macromolecule biosynthetic process
GO:0031326	0.614	regulation of cellular biosynthetic process
GO:0032206	0.593	positive regulation of telomere maintenance
GO:0006810	0.563	transport
GO:2000278	0.543	regulation of DNA biosynthetic process
GO:0051649	0.452	establishment of localization in cell
GO:1904356	0.395	regulation of telomere maintenance via telomere lengthening
GO:0010558	0.373	negative regulation of macromolecule biosynthetic process
GO:0000018	0.373	regulation of DNA recombination
GO:0031327	0.371	negative regulation of cellular biosynthetic process
GO:0032210	0.371	regulation of telomere maintenance via telomerase
GO:0045910	0.352	negative regulation of DNA recombination
GO:0032069	0.333	regulation of nuclease activity
GO:0010468	0.315	regulation of gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0000781	0.995	chromosome, telomeric region
GO:0032991	0.987	protein-containing complex
GO:0140513	0.904	nuclear protein-containing complex
GO:0016604	0.844	nuclear body
GO:0140445	0.715	chromosome, telomeric repeat region
GO:0032993	0.679	protein-DNA complex
GO:0044815	0.665	DNA packaging complex
GO:0000783	0.662	nuclear telomere cap complex
GO:0070187	0.489	shelterin complex
GO:0005737	0.384	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.7.49	0.929	RNA-directed DNA polymerase.

[back to server]