StarFunc result for job id Q15555

User Input

>input (327 residues)
MPGPTQTLSPNGENNNDIIQDNNGTIIPFRKHTVRGERSYSWGMAVNVYSTSITQETMSR
HDIIAWVNDIVSLNYTKVEQLCSGAAYCQFMDMLFPGCISLKKVKFQAKLEHEYIHNFKL
LQASFKRMNVDKVIPVEKLVKGRFQDNLDFIQWFKKFYDANYDGKEYDPVEARQGQDAIP
PPDPGEQIFNLPKKSHHANSPTAGAAKSSPAAKPGSTPSRPSSAKRASSSGSASKSDKDL
ETQVIQLNEQVHSLKLALEGVEKERDFYFGKLREIELLCQEHGQENDDLVQRLMDILYAS
EEHEGHTEEPEAEEQAHEQQPPQQEEY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15555	1.000	1.000	5.240E-50	327	1.000	1.000	Q15555.pdb.gz	MARE2_HUMAN Microtubule-associated protein RP/EB family member 2 OS=Homo sapiens OX=9606 GN=MAPRE2 PE=1 SV=1
2	AFDB:A7MC00	0.757	0.724	2.478E-37	343	0.789	0.752	A7MC00.pdb.gz	A7MC00_DANRE Microtubule-associated protein RP/EB family member 2 OS=Danio rerio OX=7955 GN=mapre2 PE=1 SV=1
3	AFDB:Q5XIT1	0.639	0.734	1.458E-27	281	0.505	0.587	Q5XIT1.pdb.gz	MARE3_RAT Microtubule-associated protein RP/EB family member 3 OS=Rattus norvegicus OX=10116 GN=Mapre3 PE=1 SV=1
4	AFDB:Q15691	0.463	0.559	1.429E-25	268	0.474	0.578	Q15691.pdb.gz	MARE1_HUMAN Microtubule-associated protein RP/EB family member 1 OS=Homo sapiens OX=9606 GN=MAPRE1 PE=1 SV=3
5	AFDB:Q9W6M6	0.445	0.558	1.872E-25	258	0.486	0.616	Q9W6M6.pdb.gz	Q9W6M6_ICTPU EB1 OS=Ictalurus punctatus OX=7998 GN=mapre1b PE=2 SV=1
6	AFDB:A1Z6P3	0.546	0.593	6.697E-23	297	0.407	0.448	A1Z6P3.pdb.gz	A1Z6P3_DROME Eb1, isoform F OS=Drosophila melanogaster OX=7227 GN=Eb1 PE=1 SV=2
7	AFDB:Q7JZD3	0.547	0.607	1.769E-22	291	0.416	0.467	Q7JZD3.pdb.gz	Q7JZD3_DROME Eb1, isoform A OS=Drosophila melanogaster OX=7227 GN=Eb1 PE=1 SV=1
8	AFDB:Q9GRZ1	0.402	0.416	6.438E-19	316	0.349	0.361	Q9GRZ1.pdb.gz	Q9GRZ1_CAEEL Microtubule End Binding Protein OS=Caenorhabditis elegans OX=6239 GN=ebp-1 PE=1 SV=1
9	PDB:2r8uB	0.396	0.944	3.063E-17	136	0.315	0.757	2r8uB.pdb.gz	Structure of fragment of human end-binding protein 1 (EB1) containing the N-terminal domain at 1.35 A resolution
10	PDB:7sj9M	0.395	0.973	3.866E-16	131	0.321	0.802	7sj9M.pdb.gz	Structural transitions in the GTP cap visualized by cryo-electron microscopy of catalytically inactive microtubules.
11	AFDB:Q9XXA2	0.413	0.450	1.295E-15	299	0.266	0.291	Q9XXA2.pdb.gz	Q9XXA2_CAEEL Calponin homology domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ebp-2 PE=1 SV=1
12	AFDB:Q9FJJ5	0.482	0.531	1.061E-14	293	0.281	0.314	Q9FJJ5.pdb.gz	EB1B_ARATH Microtubule-associated protein RP/EB family member 1B OS=Arabidopsis thaliana OX=3702 GN=EB1B PE=1 SV=1
13	PDB:7n6g6A	0.237	0.056	3.614E-1	1558	0.131	0.028	7n6g6A.pdb.gz	Cryo-EM structure of an active central apparatus.
14	PDB:7sx8D	0.269	0.201	4.026E-1	448	0.049	0.036	7sx8D.pdb.gz	Structural mechanism for bidirectional actin cross-linking by T-plastin.
15	PDB:6o4oA	0.105	0.163	1.250	169	0.046	0.089	6o4oA.pdb.gz
16	PDB:7vvuT	0.122	0.138	2.031	274	0.073	0.088	7vvuT.pdb.gz	Structure of the NuA4 acetyltransferase complex bound to the nucleosome.
17	PDB:6gs1A	0.083	0.067	2.807	472	0.058	0.040	6gs1A.pdb.gz
18	PDB:6l7oD	0.093	0.067	2.807	504	0.034	0.022	6l7oD.pdb.gz	Structural insights into NDH-1 mediated cyclic electron transfer.
19	PDB:1qgjA	0.103	0.109	3.483	300	0.024	0.027	1qgjA.pdb.gz	Arabidopsis thaliana peroxidase N: structure of a novel neutral peroxidase.
20	PDB:2d09A	0.095	0.082	4.095	404	0.049	0.040	2d09A.pdb.gz	Role of active site water molecules and substrate hydroxyl groups in oxygen activation by cytochrome P450 158A2: a new mechanism of proton transfer

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q15555	0.0	687	327	1.000	1.000	MARE2_HUMAN Microtubule-associated protein RP/EB family member 2 OS=Homo sapiens OX=9606 GN=MAPRE2 PE=1 SV=1
2	Q8R001	0.0	665	326	0.969	0.972	MARE2_MOUSE Microtubule-associated protein RP/EB family member 2 OS=Mus musculus OX=10090 GN=Mapre2 PE=1 SV=1
3	A7MC00	1.16e-173	486	343	0.768	0.732	A7MC00_DANRE Microtubule-associated protein RP/EB family member 2 OS=Danio rerio OX=7955 GN=mapre2 PE=1 SV=1
4	Q5XIT1	1.85e-119	347	281	0.517	0.601	MARE3_RAT Microtubule-associated protein RP/EB family member 3 OS=Rattus norvegicus OX=10116 GN=Mapre3 PE=1 SV=1
5	Q6PER3	1.85e-119	347	281	0.517	0.601	MARE3_MOUSE Microtubule-associated protein RP/EB family member 3 OS=Mus musculus OX=10090 GN=Mapre3 PE=1 SV=1
6	Q9UPY8	2.90e-119	346	281	0.517	0.601	MARE3_HUMAN Microtubule-associated protein RP/EB family member 3 OS=Homo sapiens OX=9606 GN=MAPRE3 PE=1 SV=1
7	Q9W6M6	3.88e-112	327	258	0.483	0.612	Q9W6M6_ICTPU EB1 OS=Ictalurus punctatus OX=7998 GN=mapre1b PE=2 SV=1
8	Q15691	1.48e-107	316	268	0.465	0.567	MARE1_HUMAN Microtubule-associated protein RP/EB family member 1 OS=Homo sapiens OX=9606 GN=MAPRE1 PE=1 SV=3
9	Q66HR2	1.39e-106	314	268	0.462	0.563	MARE1_RAT Microtubule-associated protein RP/EB family member 1 OS=Rattus norvegicus OX=10116 GN=Mapre1 PE=1 SV=3
10	Q61166	1.51e-106	313	268	0.462	0.563	MARE1_MOUSE Microtubule-associated protein RP/EB family member 1 OS=Mus musculus OX=10090 GN=Mapre1 PE=1 SV=3
11	Q7JZD3	6.42e-91	275	291	0.434	0.488	Q7JZD3_DROME Eb1, isoform A OS=Drosophila melanogaster OX=7227 GN=Eb1 PE=1 SV=1
12	Q9XZ57	1.33e-90	274	290	0.422	0.476	Q9XZ57_DROME Eb1, isoform E OS=Drosophila melanogaster OX=7227 GN=Eb1 PE=1 SV=1
13	A1Z6P3	1.83e-88	269	297	0.428	0.471	A1Z6P3_DROME Eb1, isoform F OS=Drosophila melanogaster OX=7227 GN=Eb1 PE=1 SV=2
14	Q9GRZ1	1.99e-63	205	316	0.333	0.345	Q9GRZ1_CAEEL Microtubule End Binding Protein OS=Caenorhabditis elegans OX=6239 GN=ebp-1 PE=1 SV=1
15	Q9FJJ5	1.05e-50	172	293	0.281	0.314	EB1B_ARATH Microtubule-associated protein RP/EB family member 1B OS=Arabidopsis thaliana OX=3702 GN=EB1B PE=1 SV=1
16	Q9FGQ6	1.63e-46	162	329	0.291	0.289	EB1C_ARATH Microtubule-associated protein RP/EB family member 1C OS=Arabidopsis thaliana OX=3702 GN=EB1C PE=1 SV=1
17	Q7XJ60	2.21e-46	160	276	0.269	0.319	EB1A_ARATH Microtubule-associated protein RP/EB family member 1A OS=Arabidopsis thaliana OX=3702 GN=EB1A PE=1 SV=1
18	Q10113	3.42e-43	152	308	0.269	0.286	MAL3_SCHPO Microtubule integrity protein mal3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mal3 PE=1 SV=1
19	Q9XXA2	5.22e-43	152	299	0.312	0.341	Q9XXA2_CAEEL Calponin homology domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ebp-2 PE=1 SV=1
20	P40013	7.37e-41	147	344	0.269	0.256	BIM1_YEAST Protein BIM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BIM1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11971 CAMSAP_CH	9.5	17.4	CAMSAP CH domain
2	PF00307 CH	1.1e-09	49.7	Calponin homology (CH) domain
3	PF03271 EB1	1.2e-13	62.3	EB1-like C-terminal motif
4	PF12998 ING	25	16.8	Inhibitor of growth proteins N-terminal histone-binding

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000300249

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000364721	0.892	Microtubule-associated protein RP/EB family member 1
2	9606.ENSP00000436679	0.875	Nuclear RNA export factor 1
3	9606.ENSP00000432768	0.870	Cytoskeleton-associated protein 5
4	9606.ENSP00000265148	0.860	Centromere-associated protein E
5	9606.ENSP00000454545	0.828	Putative RNA-binding protein 15B
6	9606.ENSP00000380378	0.826	Platelet-activating factor acetylhydrolase IB subunit alpha
7	9606.ENSP00000313950	0.804	Aurora kinase B
8	9606.ENSP00000479322	0.792	CAP-Gly domain-containing linker protein 1
9	9606.ENSP00000223398	0.790	CAP-Gly domain-containing linker protein 2
10	9606.ENSP00000233121	0.781	Microtubule-associated protein RP/EB family member 3
11	9606.ENSP00000260599	0.769	Ketohexokinase
12	9606.ENSP00000261332	0.767	Zinc finger protein 24
13	9606.ENSP00000327009	0.757	CAP-Gly domain containing linker protein family member 4
14	9606.ENSP00000359629	0.751	Cartilage acidic protein 1
15	9606.ENSP00000348965	0.745	Cytoplasmic dynein 1 heavy chain 1
16	9606.ENSP00000287152	0.736	Kinesin-like protein KIF6
17	9606.ENSP00000362820	0.736	Serine/arginine-rich splicing factor 3
18	9606.ENSP00000307288	0.732	DNA replication licensing factor MCM7
19	9606.ENSP00000264156	0.724	DNA replication licensing factor MCM6
20	9606.ENSP00000358799	0.722	Putative RNA-binding protein 15

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008017	1.000	microtubule binding
GO:0042802	0.974	identical protein binding
GO:0051010	0.700	microtubule plus-end binding
GO:0019899	0.571	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.982	biological regulation
GO:0050794	0.958	regulation of cellular process
GO:0009987	0.865	cellular process
GO:0048518	0.830	positive regulation of biological process
GO:0048583	0.805	regulation of response to stimulus
GO:0150116	0.768	regulation of cell-substrate junction organization
GO:0048522	0.767	positive regulation of cellular process
GO:0010646	0.738	regulation of cell communication
GO:0023051	0.735	regulation of signaling
GO:0009966	0.731	regulation of signal transduction
GO:0065009	0.717	regulation of molecular function
GO:0051056	0.649	regulation of small GTPase mediated signal transduction
GO:0071840	0.626	cellular component organization or biogenesis
GO:0016043	0.594	cellular component organization
GO:0046578	0.434	regulation of Ras protein signal transduction
GO:0050790	0.386	regulation of catalytic activity
GO:0023056	0.376	positive regulation of signaling
GO:0044093	0.373	positive regulation of molecular function
GO:0006996	0.364	organelle organization
GO:0051179	0.358	localization
GO:0051641	0.305	cellular localization
GO:0032501	0.304	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	0.999	cellular anatomical entity
GO:0043232	0.990	intracellular non-membrane-bounded organelle
GO:0030055	0.989	cell-substrate junction
GO:0005737	0.987	cytoplasm
GO:0005856	0.968	cytoskeleton
GO:0005925	0.961	focal adhesion
GO:0015630	0.958	microtubule cytoskeleton
GO:0043231	0.403	intracellular membrane-bounded organelle
GO:0005829	0.398	cytosol
GO:0005634	0.393	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]