StarFunc result for job id Q15561

User Input

>input (434 residues)
MEGTAGTITSNEWSSPTSPEGSTASGGSQALDKPIDNDAEGVWSPDIEQSFQEALAIYPP
CGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKAREIQAKLKDQ
AAKDKALQSMAAMSSAQIISATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPF
SQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPD
TYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWA
DLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYR
IHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSAS
EHGAQHHIYRLVKE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15561	1.000	1.000	1.384E-85	434	1.000	1.000	Q15561.pdb.gz	TEAD4_HUMAN Transcriptional enhancer factor TEF-3 OS=Homo sapiens OX=9606 GN=TEAD4 PE=1 SV=3
2	AFDB:H0YE88	0.581	0.592	1.235E-68	426	0.747	0.761	H0YE88.pdb.gz	H0YE88_HUMAN Transcriptional enhancer factor TEF-1 OS=Homo sapiens OX=9606 GN=TEAD1 PE=1 SV=1
3	AFDB:F1QLL3	0.609	0.625	9.261E-67	422	0.703	0.723	F1QLL3.pdb.gz
4	AFDB:Q3USK5	0.526	0.523	5.207E-63	436	0.737	0.734	Q3USK5.pdb.gz	Q3USK5_MOUSE TEA domain family member 1 OS=Mus musculus OX=10090 GN=Tead1 PE=1 SV=1
5	AFDB:P70210	0.525	0.519	5.520E-63	439	0.700	0.692	P70210.pdb.gz	TEAD3_MOUSE Transcriptional enhancer factor TEF-5 OS=Mus musculus OX=10090 GN=Tead3 PE=1 SV=2
6	AFDB:A0A024QZE2	0.556	0.537	4.798E-60	450	0.643	0.620	A0A024QZE2.pdb.gz
7	AFDB:P30052	0.507	0.500	9.219E-54	440	0.594	0.586	P30052.pdb.gz	SCAL_DROME Protein scalloped OS=Drosophila melanogaster OX=7227 GN=sd PE=1 SV=1
8	AFDB:H0YEJ9	0.438	0.513	1.576E-47	368	0.627	0.739	H0YEJ9.pdb.gz	H0YEJ9_HUMAN TEA domain transcription factor 1 OS=Homo sapiens OX=9606 GN=TEAD1 PE=1 SV=2
9	AFDB:Q19849	0.459	0.411	1.645E-40	486	0.406	0.362	Q19849.pdb.gz	EGL44_CAEEL Transcription enhancer factor-like protein egl-44 OS=Caenorhabditis elegans OX=6239 GN=egl-44 PE=1 SV=4
10	AFDB:A0A0S2Z4E5	0.443	0.805	6.124E-39	238	0.548	1.000	A0A0S2Z4E5.pdb.gz	A0A0S2Z4E5_HUMAN TEA domain family member 4 isoform 3 (Fragment) OS=Homo sapiens OX=9606 GN=TEAD4 PE=1 SV=1
11	PDB:5nalB	0.229	0.560	2.991E-5	150	0.039	0.113	5nalB.pdb.gz	Covalent Protein Labeling at Glutamic Acids.
12	PDB:4gojC	0.228	0.519	1.532E-4	161	0.032	0.087	4gojC.pdb.gz	Structural basis for Arl3-specific release of myristoylated ciliary cargo from UNC119.
13	PDB:4f38B	0.195	0.391	3.271E-4	192	0.044	0.099	4f38B.pdb.gz	Quantitative Analysis of Prenylated RhoA Interaction with Its Chaperone, RhoGDI.
14	PDB:5kwyC	0.141	0.361	1.291E-2	133	0.032	0.105	5kwyC.pdb.gz	Clues to the mechanism of cholesterol transfer from the structure of NPC1 middle lumenal domain bound to NPC2.
15	PDB:2hkaB	0.147	0.397	1.368E-2	130	0.037	0.123	2hkaB.pdb.gz	Structural Basis of Sterol Binding by NPC2, a Lysosomal Protein Deficient in Niemann-Pick Type C2 Disease
16	PDB:1xl6A	0.108	0.144	2.600E-2	291	0.037	0.055	1xl6A.pdb.gz
17	PDB:1l9mB	0.170	0.118	2.922E-2	681	0.053	0.034	1l9mB.pdb.gz	Three-dimensional structure of the human transglutaminase 3 enzyme: binding of calcium ions changes structure for activation.
18	PDB:1f13A	0.161	0.108	3.283E-2	722	0.053	0.032	1f13A.pdb.gz
19	PDB:3t6qC	0.137	0.351	4.146E-2	139	0.023	0.072	3t6qC.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
20	PDB:4wz9B	0.060	0.033	4.146E-2	887	0.025	0.012	4wz9B.pdb.gz	The Anopheles-midgut APN1 structure reveals a new malaria transmission-blocking vaccine epitope.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3DUQ6	0.0	756	361	0.832	1.000	D3DUQ6_HUMAN TEA domain family member 4 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=TEAD4 PE=1 SV=1
2	H0YE88	0.0	664	426	0.744	0.758	H0YE88_HUMAN Transcriptional enhancer factor TEF-1 OS=Homo sapiens OX=9606 GN=TEAD1 PE=1 SV=1
3	P28347	0.0	664	426	0.742	0.756	TEAD1_HUMAN Transcriptional enhancer factor TEF-1 OS=Homo sapiens OX=9606 GN=TEAD1 PE=1 SV=2
4	P30051	0.0	664	426	0.744	0.758	TEAD1_MOUSE Transcriptional enhancer factor TEF-1 OS=Mus musculus OX=10090 GN=Tead1 PE=1 SV=2
5	P70210	0.0	600	439	0.698	0.690	TEAD3_MOUSE Transcriptional enhancer factor TEF-5 OS=Mus musculus OX=10090 GN=Tead3 PE=1 SV=2
6	Q15561	0.0	907	434	1.000	1.000	TEAD4_HUMAN Transcriptional enhancer factor TEF-3 OS=Homo sapiens OX=9606 GN=TEAD4 PE=1 SV=3
7	Q15562	0.0	528	447	0.624	0.606	TEAD2_HUMAN Transcriptional enhancer factor TEF-4 OS=Homo sapiens OX=9606 GN=TEAD2 PE=1 SV=2
8	Q3USK5	0.0	652	436	0.737	0.734	Q3USK5_MOUSE TEA domain family member 1 OS=Mus musculus OX=10090 GN=Tead1 PE=1 SV=1
9	Q53GI4	0.0	905	434	0.998	0.998	Q53GI4_HUMAN TEA domain family member 4 isoform 1 variant (Fragment) OS=Homo sapiens OX=9606 GN=TEAD4 PE=1 SV=1
10	Q62296	0.0	823	427	0.922	0.937	TEAD4_MOUSE Transcriptional enhancer factor TEF-3 OS=Mus musculus OX=10090 GN=Tead4 PE=1 SV=2
11	Q7SXX3	0.0	610	393	0.668	0.738	Q7SXX3_DANRE TEA domain family member 1 OS=Danio rerio OX=7955 GN=tead1 PE=2 SV=1
12	Q99594	0.0	609	435	0.696	0.694	TEAD3_HUMAN Transcriptional enhancer factor TEF-5 OS=Homo sapiens OX=9606 GN=TEAD3 PE=1 SV=2
13	P48301	2.49e-180	512	445	0.613	0.598	TEAD2_MOUSE Transcriptional enhancer factor TEF-4 OS=Mus musculus OX=10090 GN=Tead2 PE=2 SV=1
14	E9PKB7	5.16e-174	491	330	0.544	0.715	E9PKB7_HUMAN TEA domain transcription factor 1 OS=Homo sapiens OX=9606 GN=TEAD1 PE=1 SV=1
15	H0YEJ9	8.92e-173	490	368	0.601	0.709	H0YEJ9_HUMAN TEA domain transcription factor 1 OS=Homo sapiens OX=9606 GN=TEAD1 PE=1 SV=2
16	P30052	1.97e-171	489	440	0.594	0.586	SCAL_DROME Protein scalloped OS=Drosophila melanogaster OX=7227 GN=sd PE=1 SV=1
17	A0A0S2Z4E5	9.50e-146	416	238	0.445	0.811	A0A0S2Z4E5_HUMAN TEA domain family member 4 isoform 3 (Fragment) OS=Homo sapiens OX=9606 GN=TEAD4 PE=1 SV=1
18	H0YG62	1.17e-121	353	189	0.408	0.937	H0YG62_HUMAN TEA domain transcription factor 4 (Fragment) OS=Homo sapiens OX=9606 GN=TEAD4 PE=1 SV=1
19	Q19849	4.18e-85	270	486	0.403	0.360	EGL44_CAEEL Transcription enhancer factor-like protein egl-44 OS=Caenorhabditis elegans OX=6239 GN=egl-44 PE=1 SV=4
20	H0YCZ6	2.76e-25	100	67	0.113	0.731	H0YCZ6_HUMAN TEA domain transcription factor 1 (Fragment) OS=Homo sapiens OX=9606 GN=TEAD1 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11670 MSP1a	4e+02	11.7	Major surface protein 1a (MSP1a)
2	PF01285 TEA	1.5e-23	94.2	TEA/ATTS domain
3	PF17725 YBD	1.3e-64	229.2	YAP binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000352926

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000478927	0.999	Transcriptional coactivator YAP1
2	9606.ENSP00000419465	0.998	WW domain-containing transcription regulator protein 1
3	9606.ENSP00000404251	0.997	Transcription cofactor vestigial-like protein 4
4	9606.ENSP00000359668	0.992	Transcription cofactor vestigial-like protein 1
5	9606.ENSP00000356954	0.962	Connective tissue growth factor
6	9606.ENSP00000435233	0.955	Transcriptional enhancer factor TEF-1
7	9606.ENSP00000472109	0.893	Transcriptional enhancer factor TEF-4
8	9606.ENSP00000437550	0.891	Serine/threonine-protein kinase LATS1
9	9606.ENSP00000320957	0.865	Transcription cofactor vestigial-like protein 2
10	9606.ENSP00000265165	0.852	Lymphoid enhancer-binding factor 1
11	9606.ENSP00000282111	0.852	Transcription factor 7-like 1
12	9606.ENSP00000340347	0.841	Transcription factor 7
13	9606.ENSP00000290429	0.840	Malonyl-CoA-acyl carrier protein transacylase, mitochondrial
14	9606.ENSP00000267594	0.821	Protein FAM181A
15	9606.ENSP00000370408	0.816	Homeobox protein CDX-2
16	9606.ENSP00000365295	0.812	Protein FAM181B
17	9606.ENSP00000290295	0.803	Homeobox protein Hox-B13
18	9606.ENSP00000312987	0.793	Hepatocyte nuclear factor 4-alpha
19	9606.ENSP00000372035	0.788	Serine/threonine-protein kinase LATS2
20	9606.ENSP00000259915	0.770	POU domain, class 5, transcription factor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003700	1.000	DNA-binding transcription factor activity
GO:0003677	0.999	DNA binding
GO:1990837	0.977	sequence-specific double-stranded DNA binding
GO:0000976	0.950	transcription cis-regulatory region binding
GO:0000977	0.937	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000978	0.923	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000981	0.759	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0008134	0.484	transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.999	regulation of biological process
GO:0050794	0.993	regulation of cellular process
GO:0009987	0.985	cellular process
GO:0060255	0.982	regulation of macromolecule metabolic process
GO:0009889	0.976	regulation of biosynthetic process
GO:0019219	0.976	regulation of nucleobase-containing compound metabolic process
GO:0050896	0.974	response to stimulus
GO:0051252	0.970	regulation of RNA metabolic process
GO:0048522	0.969	positive regulation of cellular process
GO:0010468	0.968	regulation of gene expression
GO:0010556	0.965	regulation of macromolecule biosynthetic process
GO:0031326	0.965	regulation of cellular biosynthetic process
GO:0006355	0.963	regulation of DNA-templated transcription
GO:0032502	0.949	developmental process
GO:0048856	0.933	anatomical structure development
GO:0006357	0.931	regulation of transcription by RNA polymerase II
GO:0010604	0.910	positive regulation of macromolecule metabolic process
GO:0051173	0.895	positive regulation of nitrogen compound metabolic process
GO:0045935	0.886	positive regulation of nucleobase-containing compound metabolic process
GO:0031328	0.885	positive regulation of cellular biosynthetic process
GO:0045893	0.876	positive regulation of DNA-templated transcription
GO:0051716	0.861	cellular response to stimulus
GO:0032501	0.855	multicellular organismal process
GO:0007275	0.832	multicellular organism development
GO:0045944	0.738	positive regulation of transcription by RNA polymerase II
GO:0023052	0.665	signaling
GO:0007154	0.665	cell communication
GO:0007165	0.658	signal transduction
GO:0048731	0.646	system development
GO:0035556	0.618	intracellular signal transduction
GO:0050793	0.383	regulation of developmental process
GO:0048519	0.370	negative regulation of biological process
GO:0048513	0.369	animal organ development
GO:0048523	0.358	negative regulation of cellular process
GO:0030154	0.337	cell differentiation
GO:0051239	0.311	regulation of multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.942	protein-containing complex
GO:0005737	0.903	cytoplasm
GO:0005829	0.763	cytosol
GO:0005667	0.653	transcription regulator complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]