StarFunc result for job id Q15562

User Input

>input (447 residues)
MGEPRAGAALDDGSGWTGSEEGSEEGTGGSEGAGGDGGPDAEGVWSPDIEQSFQEALAIY
PPCGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKSREIQSKLK
DQVSKDKAFQTMATMSSAQLISAPSLQAKLGPTGPQASELFQFWSGGSGPPWNVPDVKPF
SQTPFTLSLTPPSTDLPGYEPPQALSPLPPPTPSPPAWQARGLGTARLQLVEFSAFVEPP
DAVDSYQRHLFVHISQHCPSPGAPPLESVDVRQIYDKFPEKKGGLRELYDRGPPHAFFLV
KFWADLNWGPSGEEAGAGGSISSGGFYGVSSQYESLEHMTLTCSSKVCSFGKQVVEKVET
ERAQLEDGRFVYRLLRSPMCEYLVNFLHKLRQLPERYMMNSVLENFTILQVVTNRDTQEL
LLCTAYVFEVSTSERGAQHHIYRLVRD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024QZE2	0.586	0.582	4.081E-81	450	1.000	0.993	A0A024QZE2.pdb.gz
2	AFDB:Q15561	0.730	0.751	8.909E-63	434	0.631	0.650	Q15561.pdb.gz	TEAD4_HUMAN Transcriptional enhancer factor TEF-3 OS=Homo sapiens OX=9606 GN=TEAD4 PE=1 SV=3
3	AFDB:H0YE88	0.552	0.578	2.487E-61	426	0.642	0.674	H0YE88.pdb.gz	H0YE88_HUMAN Transcriptional enhancer factor TEF-1 OS=Homo sapiens OX=9606 GN=TEAD1 PE=1 SV=1
4	AFDB:F1QLL3	0.593	0.626	1.921E-60	422	0.615	0.652	F1QLL3.pdb.gz
5	AFDB:P70210	0.495	0.504	6.606E-58	439	0.629	0.640	P70210.pdb.gz	TEAD3_MOUSE Transcriptional enhancer factor TEF-5 OS=Mus musculus OX=10090 GN=Tead3 PE=1 SV=2
6	AFDB:Q3USK5	0.502	0.514	6.832E-57	436	0.629	0.644	Q3USK5.pdb.gz	Q3USK5_MOUSE TEA domain family member 1 OS=Mus musculus OX=10090 GN=Tead1 PE=1 SV=1
7	AFDB:P30052	0.489	0.496	2.256E-50	440	0.537	0.545	P30052.pdb.gz	SCAL_DROME Protein scalloped OS=Drosophila melanogaster OX=7227 GN=sd PE=1 SV=1
8	AFDB:H0YEJ9	0.439	0.528	1.058E-43	368	0.544	0.660	H0YEJ9.pdb.gz	H0YEJ9_HUMAN TEA domain transcription factor 1 OS=Homo sapiens OX=9606 GN=TEAD1 PE=1 SV=2
9	AFDB:Q19849	0.439	0.405	2.717E-41	486	0.394	0.362	Q19849.pdb.gz	EGL44_CAEEL Transcription enhancer factor-like protein egl-44 OS=Caenorhabditis elegans OX=6239 GN=egl-44 PE=1 SV=4
10	AFDB:A0A0S2Z4E5	0.420	0.782	2.363E-33	238	0.409	0.769	A0A0S2Z4E5.pdb.gz	A0A0S2Z4E5_HUMAN TEA domain family member 4 isoform 3 (Fragment) OS=Homo sapiens OX=9606 GN=TEAD4 PE=1 SV=1
11	PDB:5nalB	0.219	0.562	3.505E-5	150	0.040	0.120	5nalB.pdb.gz	Covalent Protein Labeling at Glutamic Acids.
12	PDB:4gojC	0.227	0.540	1.907E-4	161	0.027	0.075	4gojC.pdb.gz	Structural basis for Arl3-specific release of myristoylated ciliary cargo from UNC119.
13	PDB:4f38B	0.182	0.381	9.229E-4	192	0.031	0.073	4f38B.pdb.gz	Quantitative Analysis of Prenylated RhoA Interaction with Its Chaperone, RhoGDI.
14	PDB:1l9mB	0.157	0.112	3.336E-3	681	0.049	0.032	1l9mB.pdb.gz	Three-dimensional structure of the human transglutaminase 3 enzyme: binding of calcium ions changes structure for activation.
15	PDB:1f13A	0.141	0.094	9.003E-3	722	0.043	0.026	1f13A.pdb.gz
16	PDB:7tysA	0.110	0.131	9.544E-3	361	0.031	0.039	7tysA.pdb.gz	Ligand-mediated Structural Dynamics of a Mammalian Pancreatic K ATP Channel.
17	PDB:5kwyC	0.138	0.370	1.712E-2	133	0.034	0.113	5kwyC.pdb.gz	Clues to the mechanism of cholesterol transfer from the structure of NPC1 middle lumenal domain bound to NPC2.
18	PDB:2hkaB	0.151	0.420	1.815E-2	130	0.034	0.115	2hkaB.pdb.gz	Structural Basis of Sterol Binding by NPC2, a Lysosomal Protein Deficient in Niemann-Pick Type C2 Disease
19	PDB:5ijdC	0.109	0.277	2.039E-2	137	0.029	0.095	5ijdC.pdb.gz	TLR4/MD-2 activation by a synthetic agonist with no similarity to LPS.
20	PDB:3t6qC	0.133	0.346	2.162E-2	139	0.020	0.065	3t6qC.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	H0YE88	0.0	562	426	0.651	0.683	H0YE88_HUMAN Transcriptional enhancer factor TEF-1 OS=Homo sapiens OX=9606 GN=TEAD1 PE=1 SV=1
2	P28347	0.0	562	426	0.651	0.683	TEAD1_HUMAN Transcriptional enhancer factor TEF-1 OS=Homo sapiens OX=9606 GN=TEAD1 PE=1 SV=2
3	P30051	0.0	561	426	0.651	0.683	TEAD1_MOUSE Transcriptional enhancer factor TEF-1 OS=Mus musculus OX=10090 GN=Tead1 PE=1 SV=2
4	P48301	0.0	755	445	0.924	0.928	TEAD2_MOUSE Transcriptional enhancer factor TEF-4 OS=Mus musculus OX=10090 GN=Tead2 PE=2 SV=1
5	P70210	0.0	520	439	0.622	0.633	TEAD3_MOUSE Transcriptional enhancer factor TEF-5 OS=Mus musculus OX=10090 GN=Tead3 PE=1 SV=2
6	Q15561	0.0	536	434	0.629	0.647	TEAD4_HUMAN Transcriptional enhancer factor TEF-3 OS=Homo sapiens OX=9606 GN=TEAD4 PE=1 SV=3
7	Q15562	0.0	920	447	1.000	1.000	TEAD2_HUMAN Transcriptional enhancer factor TEF-4 OS=Homo sapiens OX=9606 GN=TEAD2 PE=1 SV=2
8	Q3USK5	0.0	538	436	0.629	0.644	Q3USK5_MOUSE TEA domain family member 1 OS=Mus musculus OX=10090 GN=Tead1 PE=1 SV=1
9	Q53GI4	0.0	536	434	0.626	0.645	Q53GI4_HUMAN TEA domain family member 4 isoform 1 variant (Fragment) OS=Homo sapiens OX=9606 GN=TEAD4 PE=1 SV=1
10	Q62296	0.0	535	427	0.606	0.635	TEAD4_MOUSE Transcriptional enhancer factor TEF-3 OS=Mus musculus OX=10090 GN=Tead4 PE=1 SV=2
11	Q7SXX3	0.0	523	393	0.586	0.667	Q7SXX3_DANRE TEA domain family member 1 OS=Danio rerio OX=7955 GN=tead1 PE=2 SV=1
12	Q99594	0.0	540	435	0.626	0.644	TEAD3_HUMAN Transcriptional enhancer factor TEF-5 OS=Homo sapiens OX=9606 GN=TEAD3 PE=1 SV=2
13	D3DUQ6	5.38e-160	457	361	0.530	0.657	D3DUQ6_HUMAN TEA domain family member 4 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=TEAD4 PE=1 SV=1
14	P30052	5.30e-148	430	440	0.519	0.527	SCAL_DROME Protein scalloped OS=Drosophila melanogaster OX=7227 GN=sd PE=1 SV=1
15	E9PKB7	1.62e-135	394	330	0.461	0.624	E9PKB7_HUMAN TEA domain transcription factor 1 OS=Homo sapiens OX=9606 GN=TEAD1 PE=1 SV=1
16	A0A0S2Z4E5	6.80e-102	305	238	0.320	0.601	A0A0S2Z4E5_HUMAN TEA domain family member 4 isoform 3 (Fragment) OS=Homo sapiens OX=9606 GN=TEAD4 PE=1 SV=1
17	H0YEJ9	4.23e-84	264	368	0.333	0.405	H0YEJ9_HUMAN TEA domain transcription factor 1 OS=Homo sapiens OX=9606 GN=TEAD1 PE=1 SV=2
18	Q19849	1.22e-79	256	486	0.396	0.364	EGL44_CAEEL Transcription enhancer factor-like protein egl-44 OS=Caenorhabditis elegans OX=6239 GN=egl-44 PE=1 SV=4
19	H0YG62	2.26e-39	142	189	0.213	0.503	H0YG62_HUMAN TEA domain transcription factor 4 (Fragment) OS=Homo sapiens OX=9606 GN=TEAD4 PE=1 SV=1
20	H0YCZ6	3.13e-22	92.0	67	0.103	0.687	H0YCZ6_HUMAN TEA domain transcription factor 1 (Fragment) OS=Homo sapiens OX=9606 GN=TEAD1 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01285 TEA	1.4e-23	94.2	TEA/ATTS domain
2	PF17725 YBD	7.9e-61	216.8	YAP binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000015975

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000005677	0.970	Yes associated protein 1
2	9593.ENSGGOP00000018062	0.970	Yes-associated protein 1
3	9593.ENSGGOP00000000210	0.893	WW domain containing transcription regulator 1
4	9593.ENSGGOP00000013698	0.835	Vestigial-like family member 2
5	9593.ENSGGOP00000003441	0.764	Vestigial-like family member 4
6	9593.ENSGGOP00000019604	0.700	INSM transcriptional repressor 1
7	9593.ENSGGOP00000022529	0.700	INSM transcriptional repressor 2
8	9593.ENSGGOP00000015740	0.685	Coiled-coil domain containing 155
9	9593.ENSGGOP00000015982	0.656	Dickkopf-like 1
10	9593.ENSGGOP00000010719	0.652	Tetraspanin 9
11	9593.ENSGGOP00000023646	0.651	Connective tissue growth factor
12	9593.ENSGGOP00000006082	0.650	Transcriptional enhancer factor TEF-3
13	9593.ENSGGOP00000003936	0.649	Ethanolamine kinase 1
14	9593.ENSGGOP00000006409	0.618	Vestigial-like family member 1
15	9593.ENSGGOP00000003352	0.606	TEA domain family member 1 (SV40 transcriptional enhancer factor)
16	9593.ENSGGOP00000000536	0.572	Large tumor suppressor kinase 1
17	9593.ENSGGOP00000009274	0.570	Vestigial-like family member 3
18	9593.ENSGGOP00000009895	0.570	Aldehyde dehydrogenase 16 family, member A1
19	9593.ENSGGOP00000019308	0.570	PIH1 domain containing 1
20	9593.ENSGGOP00000001342	0.549	Phosphatidylinositol-4-phosphate 3-kinase, catalytic subunit type 2 beta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003700	1.000	DNA-binding transcription factor activity
GO:0003690	0.999	double-stranded DNA binding
GO:0043565	0.998	sequence-specific DNA binding
GO:1990837	0.986	sequence-specific double-stranded DNA binding
GO:0000976	0.926	transcription cis-regulatory region binding
GO:0000977	0.900	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000987	0.868	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.831	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000981	0.569	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0008134	0.361	transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048522	0.995	positive regulation of cellular process
GO:0045893	0.988	positive regulation of DNA-templated transcription
GO:0009987	0.981	cellular process
GO:0006357	0.916	regulation of transcription by RNA polymerase II
GO:0050896	0.897	response to stimulus
GO:0045944	0.722	positive regulation of transcription by RNA polymerase II
GO:0048856	0.721	anatomical structure development
GO:0051716	0.673	cellular response to stimulus
GO:0032501	0.669	multicellular organismal process
GO:0007154	0.618	cell communication
GO:0007165	0.610	signal transduction
GO:0035556	0.588	intracellular signal transduction
GO:0007275	0.551	multicellular organism development
GO:0048731	0.484	system development
GO:0008152	0.443	metabolic process
GO:0044237	0.378	cellular metabolic process
GO:0071704	0.376	organic substance metabolic process
GO:0044238	0.368	primary metabolic process
GO:0048519	0.331	negative regulation of biological process
GO:0048523	0.308	negative regulation of cellular process
GO:0071840	0.303	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005829	0.988	cytosol
GO:0032991	0.979	protein-containing complex
GO:0005667	0.604	transcription regulator complex
GO:0090575	0.398	RNA polymerase II transcription regulator complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]