StarFunc result for job id Q15569

User Input

>input (626 residues)
MAGERPPLRGPGPGPGEVPGEGPPGPGGTGGGPGRGRPSSYRALRSAVSSLARVDDFHCA
EKIGAGFFSEVYKVRHRQSGQVMVLKMNKLPSNRGNTLREVQLMNRLRHPNILRFMGVCV
HQGQLHALTEYMNGGTLEQLLSSPEPLSWPVRLHLALDIARGLRYLHSKGVFHRDLTSKN
CLVRREDRGFTAVVGDFGLAEKIPVYREGARKEPLAVVGSPYWMAPEVLRGELYDEKADV
FAFGIVLCELIARVPADPDYLPRTEDFGLDVPAFRTLVGDDCPLPFLLLAIHCCNLEPST
RAPFTEITQHLEWILEQLPEPAPLTRTALTHNQGSVARGGPSATLPRPDPRLSRSRSDLF
LPPSPESPPNWGDNLTRVNPFSLREDLRGGKIKLLDTPSKPVLPLVPPSPFPSTQLPLVT
TPETLVQPGTPARRCRSLPSSPELPRRMETALPGPGPPAVGPSAEEKMECEGSSPEPEPP
GPAPQLPLAVATDNFISTCSSASQPWSPRSGPVLNNNPPAVVVNSPQGWAGEPWNRAQHS
LPRAAALERTEPSPPPSAPREPDEGLPCPGCCLGPFSFGFLSMCPRPTPAVARYRNLNCE
AGSLLCHRGHHAKPPTPSLQLPGARS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q63572	0.568	0.567	6.566E-90	628	0.923	0.920	Q63572.pdb.gz	TESK1_RAT Dual specificity testis-specific protein kinase 1 OS=Rattus norvegicus OX=10116 GN=Tesk1 PE=1 SV=1
2	AFDB:E9PT20	0.343	0.195	2.217E-19	1143	0.217	0.119	E9PT20.pdb.gz	E9PT20_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Abl1 PE=3 SV=1
3	PDB:2qkwB	0.366	0.754	4.478E-19	292	0.113	0.243	2qkwB.pdb.gz
4	PDB:8dksA	0.344	0.726	6.675E-19	283	0.113	0.251	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
5	AFDB:A0A024R8E2	0.343	0.197	9.226E-19	1130	0.219	0.121	A0A024R8E2.pdb.gz
6	PDB:1k9aB	0.350	0.487	3.491E-18	441	0.125	0.177	1k9aB.pdb.gz
7	AFDB:P42684	0.341	0.189	5.407E-18	1182	0.200	0.106	P42684.pdb.gz	ABL2_HUMAN Tyrosine-protein kinase ABL2 OS=Homo sapiens OX=9606 GN=ABL2 PE=1 SV=1
8	PDB:4krcA	0.351	0.710	1.224E-17	297	0.115	0.242	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
9	PDB:5u6yA	0.344	0.461	1.538E-17	459	0.118	0.161	5u6yA.pdb.gz
10	PDB:4rerA	0.356	0.478	2.293E-17	459	0.118	0.161	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
11	AFDB:E7ETY4	0.352	0.291	2.993E-17	763	0.217	0.178	E7ETY4.pdb.gz	E7ETY4_HUMAN non-specific serine/threonine protein kinase OS=Homo sapiens OX=9606 GN=MARK2 PE=1 SV=2
12	AFDB:O08679	0.349	0.305	4.215E-17	722	0.204	0.177	O08679.pdb.gz	MARK2_RAT Serine/threonine-protein kinase MARK2 OS=Rattus norvegicus OX=10116 GN=Mark2 PE=1 SV=1
13	PDB:5ufuA	0.355	0.586	6.778E-17	369	0.117	0.198	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
14	PDB:4eomC	0.370	0.802	7.597E-17	276	0.113	0.257	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
15	PDB:3mi9A	0.372	0.688	1.199E-16	329	0.118	0.225	3mi9A.pdb.gz	Crystal structure of HIV-1 Tat complexed with human P-TEFb.
16	PDB:4zhxA	0.354	0.530	1.787E-16	409	0.112	0.171	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
17	AFDB:Q9JM52	0.358	0.180	1.448E-15	1308	0.240	0.115	Q9JM52.pdb.gz	MINK1_MOUSE Misshapen-like kinase 1 OS=Mus musculus OX=10090 GN=Mink1 PE=1 SV=3
18	AFDB:Q0KHT7	0.364	0.340	1.819E-15	674	0.150	0.139	Q0KHT7.pdb.gz	DAPKR_DROME Death-associated protein kinase related OS=Drosophila melanogaster OX=7227 GN=Drak PE=1 SV=2
19	AFDB:F1LP90	0.351	0.171	3.218E-15	1336	0.232	0.109	F1LP90.pdb.gz	MINK1_RAT Misshapen-like kinase 1 OS=Rattus norvegicus OX=10116 GN=Mink1 PE=1 SV=2
20	AFDB:Q03002	0.339	0.248	3.218E-15	865	0.192	0.139	Q03002.pdb.gz	FRK1_YEAST Fatty acyl-CoA synthetase and RNA processing-associated kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FRK1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O70146	0.0	1037	627	0.874	0.872	TESK1_MOUSE Dual specificity testis-specific protein kinase 1 OS=Mus musculus OX=10090 GN=Tesk1 PE=1 SV=3
2	Q15569	0.0	1247	626	1.000	1.000	TESK1_HUMAN Dual specificity testis-specific protein kinase 1 OS=Homo sapiens OX=9606 GN=TESK1 PE=1 SV=2
3	Q63572	0.0	1021	628	0.917	0.914	TESK1_RAT Dual specificity testis-specific protein kinase 1 OS=Rattus norvegicus OX=10116 GN=Tesk1 PE=1 SV=1
4	Q96S53	1.94e-150	448	571	0.401	0.440	TESK2_HUMAN Dual specificity testis-specific protein kinase 2 OS=Homo sapiens OX=9606 GN=TESK2 PE=1 SV=1
5	Q924U5	2.03e-146	437	570	0.390	0.428	TESK2_RAT Dual specificity testis-specific protein kinase 2 OS=Rattus norvegicus OX=10116 GN=Tesk2 PE=2 SV=1
6	Q9VE06	5.23e-103	340	1213	0.268	0.138	Q9VE06_DROME Center divider, isoform A OS=Drosophila melanogaster OX=7227 GN=cdi PE=2 SV=1
7	E1JJM8	1.47e-67	240	1043	0.203	0.122	E1JJM8_DROME LIM domain kinase 1, isoform F OS=Drosophila melanogaster OX=7227 GN=LIMK1 PE=4 SV=1
8	P53670	1.66e-67	234	638	0.212	0.208	LIMK2_RAT LIM domain kinase 2 OS=Rattus norvegicus OX=10116 GN=Limk2 PE=2 SV=1
9	O54785	3.58e-67	233	638	0.214	0.210	LIMK2_MOUSE LIM domain kinase 2 OS=Mus musculus OX=10090 GN=Limk2 PE=1 SV=2
10	P53671	4.13e-67	233	638	0.216	0.212	LIMK2_HUMAN LIM domain kinase 2 OS=Homo sapiens OX=9606 GN=LIMK2 PE=1 SV=1
11	Q8IR79	9.43e-67	239	1257	0.203	0.101	LIMK1_DROME LIM domain kinase 1 OS=Drosophila melanogaster OX=7227 GN=LIMK1 PE=1 SV=1
12	E1JJM7	9.46e-67	239	1235	0.203	0.103	E1JJM7_DROME LIM domain kinase 1, isoform E OS=Drosophila melanogaster OX=7227 GN=LIMK1 PE=3 SV=1
13	P53669	6.90e-66	229	647	0.204	0.198	LIMK1_RAT LIM domain kinase 1 OS=Rattus norvegicus OX=10116 GN=Limk1 PE=1 SV=1
14	P53668	1.77e-65	228	647	0.203	0.196	LIMK1_MOUSE LIM domain kinase 1 OS=Mus musculus OX=10090 GN=Limk1 PE=1 SV=1
15	E9PC47	7.29e-65	228	677	0.200	0.185	E9PC47_HUMAN LIM domain kinase 1 OS=Homo sapiens OX=9606 GN=LIMK1 PE=1 SV=1
16	P53667	1.35e-64	226	647	0.200	0.193	LIMK1_HUMAN LIM domain kinase 1 OS=Homo sapiens OX=9606 GN=LIMK1 PE=1 SV=3
17	Q0PWB7	1.43e-64	226	648	0.204	0.198	Q0PWB7_DANRE LIM domain kinase 1 OS=Danio rerio OX=7955 GN=limk1 PE=2 SV=1
18	C0LGD7	9.52e-34	140	953	0.157	0.103	Y1684_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g06840 OS=Arabidopsis thaliana OX=3702 GN=At1g06840 PE=1 SV=2
19	Q2MHE4	1.94e-33	134	390	0.157	0.251	HT1_ARATH Serine/threonine/tyrosine-protein kinase HT1 OS=Arabidopsis thaliana OX=3702 GN=HT1 PE=1 SV=1
20	Q05609	2.05e-33	139	821	0.133	0.101	CTR1_ARATH Serine/threonine-protein kinase CTR1 OS=Arabidopsis thaliana OX=3702 GN=CTR1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01636 APH	0.68	21.3	Phosphotransferase enzyme family
2	PF06293 Kdo	2	19.3	Lipopolysaccharide kinase (Kdo/WaaP) family
3	PF00069 Pkinase	3.9e-41	152.8	Protein kinase domain
4	PF17667 Pkinase_fungal	9.9	16.4	Fungal protein kinase
5	PF07714 PK_Tyr_Ser-Thr	2.1e-42	156.8	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000481045

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000344967	0.921	Protein sprouty homolog 4
2	9606.ENSP00000334008	0.917	Alpha-parvin
3	9606.ENSP00000393922	0.748	Iporin
4	9606.ENSP00000432660	0.707	Cofilin-1
5	9606.ENSP00000290583	0.680	CUGBP Elav-like family member 3
6	9606.ENSP00000299084	0.671	Sprouty-related, EVH1 domain-containing protein 1
7	9606.ENSP00000478591	0.667	E3 ubiquitin-protein ligase NEURL3
8	9606.ENSP00000312081	0.660	Protein phosphatase Slingshot homolog 3
9	9606.ENSP00000481675	0.653	Protein sprouty homolog 1
10	9606.ENSP00000215904	0.642	Pyridoxal phosphate phosphatase
11	9606.ENSP00000315713	0.641	Protein phosphatase Slingshot homolog 1
12	9606.ENSP00000366306	0.627	Protein sprouty homolog 2
13	9606.ENSP00000323046	0.577	Exosome complex component RRP40
14	9606.ENSP00000444743	0.574	Protein phosphatase Slingshot homolog 2
15	9606.ENSP00000277010	0.569	Sigma non-opioid intracellular receptor 1
16	9606.ENSP00000371711	0.549	Doublesex- and mab-3-related transcription factor 1
17	9606.ENSP00000358815	0.544	E3 ubiquitin-protein ligase NEURL1B
18	9606.ENSP00000333097	0.539	Factor in the germline alpha
19	9606.ENSP00000263038	0.532	Phytanoyl-CoA dioxygenase, peroxisomal
20	9606.ENSP00000223500	0.531	Charged multivesicular body protein 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004674	1.000	protein serine/threonine kinase activity
GO:0019899	0.394	enzyme binding
GO:0019901	0.321	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.995	biological regulation
GO:0051493	0.988	regulation of cytoskeleton organization
GO:0009987	0.985	cellular process
GO:0032956	0.983	regulation of actin cytoskeleton organization
GO:0051174	0.956	regulation of phosphorus metabolic process
GO:1902903	0.898	regulation of supramolecular fiber organization
GO:0048522	0.897	positive regulation of cellular process
GO:0032501	0.893	multicellular organismal process
GO:0048523	0.890	negative regulation of cellular process
GO:0110053	0.882	regulation of actin filament organization
GO:0019220	0.851	regulation of phosphate metabolic process
GO:0044087	0.838	regulation of cellular component biogenesis
GO:0032502	0.822	developmental process
GO:0032231	0.808	regulation of actin filament bundle assembly
GO:1902905	0.782	positive regulation of supramolecular fiber organization
GO:0051495	0.777	positive regulation of cytoskeleton organization
GO:0060255	0.739	regulation of macromolecule metabolic process
GO:0051171	0.733	regulation of nitrogen compound metabolic process
GO:0080090	0.730	regulation of primary metabolic process
GO:0000003	0.717	reproduction
GO:0031399	0.716	regulation of protein modification process
GO:0032233	0.688	positive regulation of actin filament bundle assembly
GO:0045936	0.681	negative regulation of phosphate metabolic process
GO:0042325	0.666	regulation of phosphorylation
GO:0048609	0.656	multicellular organismal reproductive process
GO:0044237	0.590	cellular metabolic process
GO:0001932	0.556	regulation of protein phosphorylation
GO:0051496	0.533	positive regulation of stress fiber assembly
GO:0071704	0.530	organic substance metabolic process
GO:0044238	0.505	primary metabolic process
GO:0050896	0.455	response to stimulus
GO:0071840	0.447	cellular component organization or biogenesis
GO:0016043	0.408	cellular component organization
GO:0051716	0.367	cellular response to stimulus
GO:0007283	0.355	spermatogenesis
GO:0065009	0.326	regulation of molecular function

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043229	1.000	intracellular organelle
GO:0043231	0.989	intracellular membrane-bounded organelle
GO:0043232	0.981	intracellular non-membrane-bounded organelle
GO:0005829	0.976	cytosol
GO:0031982	0.855	vesicle
GO:0005856	0.772	cytoskeleton
GO:0016020	0.659	membrane
GO:0005634	0.355	nucleus
GO:0015630	0.348	microtubule cytoskeleton
GO:0012505	0.334	endomembrane system
GO:0071944	0.303	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]