StarFunc result for job id Q15572

User Input

>input (869 residues)
MDFPSSLRPALFLTGPLGLSDVPDLSFMCSWRDALTLPEAQPQNSENGALHVTKDLLWEP
ATPGPLPMLPPLIDPWDPGLTARDLLFRGGCRYRKRPRVVLDVTEQISRFLLDHGDVAFA
PLGKLMLENFKLEGAGSRTKKKTVVSVKKLLQDLGGHQPWGCPWAYLSNRQRRFSILGGP
ILGTSVASHLAELLHEELVLRWEQLLLDEACTGGALAWVPGRTPQFGQLVYPAGGAQDRL
HFQEVVLTPGDNPQFLGKPGRIQLQGPVRQVVTCTVQGESKALIYTFLPHWLTCYLTPGP
FHPSSALLAVRSDYHCAVWKFGKQWQPTLLQAMQVEKGATGISLSPHLPGELAICSRSGA
VCLWSPEDGLRQIYRDPETLVFRDSSSWRWADFTAHPRVLTVGDRTGVKMLDTQGPPGCG
LLLFRLGAEASCQKGERVLLTQYLGHSSPKCLPPTLHLVCTQFSLYLVDERLPLVPMLKW
NHGLPSPLLLARLLPPPRPSCVQPLLLGGQGGQLQLLHLAGEGASVPRLAGPPQSLPSRI
DSLPAFPLLEPKIQWRLQERLKAPTIGLAAVVPPLPSAPTPGLVLFQLSAAGDVFYQQLR
PQVDSSLRRDAGPPGDTQPDCHAPTASWTSQDTAGCSQWLKALLKVPLAPPVWTAPTFTH
RQMLGSTELRREEEEGQRLGVLRKAMARGQLLLQRDLGSLPAAEPPPAPESGLEDKLSER
LGEAWAGRGAAWWERQQGRTSEPGRQTRRPKRRTQLSSSFSLSGHVDPSEDTSSPHSPEW
PPADALPLPPTTPPSQELTPDACAQGVPSEQRQMLRDYMAKLPPQRDTPGCATTPPHSQA
SSVRATRSQQHTPVLSSSQPLRKKPRMGF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15572	1.000	1.000	0.000	869	1.000	1.000	Q15572.pdb.gz	TAF1C_HUMAN TATA box-binding protein-associated factor RNA polymerase I subunit C OS=Homo sapiens OX=9606 GN=TAF1C PE=1 SV=2
2	PDB:7wb4c	0.284	0.647	6.781E-11	346	0.059	0.147	7wb4c.pdb.gz
3	PDB:5w5yO	0.296	0.390	2.189E-10	640	0.070	0.095	5w5yO.pdb.gz	Structural mechanism of ATP-independent transcription initiation by RNA polymerase I.
4	PDB:6rqhS	0.292	0.400	6.717E-10	610	0.055	0.079	6rqhS.pdb.gz	Molecular insight into RNA polymerase I promoter recognition and promoter melting.
5	PDB:7kzmD	0.253	0.440	6.009E-9	456	0.076	0.145	7kzmD.pdb.gz	Structure of a microtubule-bound axonemal dynein.
6	PDB:7z8bF	0.242	0.422	6.009E-9	457	0.056	0.107	7z8bF.pdb.gz	Structure of CRL7 FBXW8 reveals coupling with CUL1-RBX1/ROC1 for multi-cullin-RING E3-catalyzed ubiquitin ligation.
7	PDB:7ajtUO	0.277	0.462	6.323E-9	493	0.049	0.087	7ajtUO.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
8	PDB:7r5jQ0	0.274	0.628	7.002E-9	345	0.066	0.165	7r5jQ0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
9	PDB:7mqaLW	0.261	0.463	9.034E-9	452	0.094	0.181	7mqaLW.pdb.gz	Nucleolar maturation of the human small subunit processome.
10	PDB:5lj5t	0.243	0.429	1.000E-8	438	0.054	0.107	5lj5t.pdb.gz	Cryo-EM structure of the spliceosome immediately after branching.
11	PDB:7mq8LW	0.259	0.459	1.053E-8	453	0.098	0.188	7mq8LW.pdb.gz	Nucleolar maturation of the human small subunit processome.
12	AFDB:M9PHU0	0.239	0.103	3.431E-8	2263	0.112	0.043	M9PHU0.pdb.gz	M9PHU0_DROME Uncharacterized protein, isoform C OS=Drosophila melanogaster OX=7227 GN=CG12432 PE=1 SV=1
13	AFDB:B8A474	0.221	0.248	6.324E-8	760	0.102	0.117	B8A474.pdb.gz
14	AFDB:Q8N157	0.260	0.195	9.909E-7	1196	0.064	0.047	Q8N157.pdb.gz	AHI1_HUMAN Jouberin OS=Homo sapiens OX=9606 GN=AHI1 PE=1 SV=1
15	AFDB:Q6PCD5	0.239	0.265	1.650E-6	774	0.085	0.096	Q6PCD5.pdb.gz	RFWD3_HUMAN E3 ubiquitin-protein ligase RFWD3 OS=Homo sapiens OX=9606 GN=RFWD3 PE=1 SV=3
16	AFDB:Q8MY12	0.249	0.275	3.040E-6	780	0.058	0.064	Q8MY12.pdb.gz	MHCKC_DICDI Myosin heavy chain kinase C OS=Dictyostelium discoideum OX=44689 GN=mhkC PE=1 SV=1
17	AFDB:Q86LC4	0.212	0.275	3.367E-6	646	0.092	0.124	Q86LC4.pdb.gz	Q86LC4_DROME Gamma-tubulin ring complex subunit Dgrip71 OS=Drosophila melanogaster OX=7227 GN=Grip71 PE=2 SV=1
18	AFDB:Q5JSH3	0.280	0.268	5.061E-6	913	0.087	0.083	Q5JSH3.pdb.gz	WDR44_HUMAN WD repeat-containing protein 44 OS=Homo sapiens OX=9606 GN=WDR44 PE=1 SV=1
19	AFDB:Q23256	0.260	0.429	5.326E-6	501	0.087	0.152	Q23256.pdb.gz	WDR53_CAEEL WD repeat-containing protein wdr-5.3 OS=Caenorhabditis elegans OX=6239 GN=wdr-5.3 PE=3 SV=1
20	AFDB:A0A0R4IEP9	0.237	0.165	5.842E-5	1332	0.087	0.057	A0A0R4IEP9.pdb.gz	A0A0R4IEP9_DANRE TRAF2 and NCK interacting kinase a isoform X4 OS=Danio rerio OX=7955 GN=fc52d11 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	H3BR71	0.0	723	380	0.436	0.997	H3BR71_HUMAN TATA-box binding protein associated factor, RNA polymerase I subunit C (Fragment) OS=Homo sapiens OX=9606 GN=TAF1C PE=1 SV=1
2	Q15572	0.0	1728	869	1.000	1.000	TAF1C_HUMAN TATA box-binding protein-associated factor RNA polymerase I subunit C OS=Homo sapiens OX=9606 GN=TAF1C PE=1 SV=2
3	Q6PDZ2	0.0	968	836	0.633	0.658	TAF1C_MOUSE TATA box-binding protein-associated factor RNA polymerase I subunit C OS=Mus musculus OX=10090 GN=Taf1c PE=1 SV=1
4	A0A087X0X5	0.098	37.7	227	0.028	0.106	A0A087X0X5_HUMAN Damage-specific DNA-binding protein 2 (Fragment) OS=Homo sapiens OX=9606 GN=DDB2 PE=1 SV=6
5	Q92466	0.18	37.7	427	0.030	0.061	DDB2_HUMAN DNA damage-binding protein 2 OS=Homo sapiens OX=9606 GN=DDB2 PE=1 SV=1
6	R4GE89	0.37	35.8	198	0.030	0.131	R4GE89_DANRE Hemogen OS=Danio rerio OX=7955 GN=si:dkey-25o16.2 PE=4 SV=1
7	R4GDZ7	0.42	35.4	194	0.030	0.134	R4GDZ7_DANRE Hemogen OS=Danio rerio OX=7955 GN=si:dkey-25o16.2 PE=4 SV=1
8	Q57TT6	1.7	34.7	419	0.024	0.050	Q57TT6_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.30K1.680 PE=4 SV=1
9	Q99J79	3.4	33.5	432	0.038	0.076	DDB2_MOUSE DNA damage-binding protein 2 OS=Mus musculus OX=10090 GN=Ddb2 PE=1 SV=1
10	M9PC48	5.7	33.1	18095	0.022	0.001	M9PC48_DROME Dumpy, isoform Y OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
11	M9PCJ6	5.7	33.1	18641	0.022	0.001	M9PCJ6_DROME Dumpy, isoform S OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
12	Q13585	7.1	32.7	617	0.039	0.055	MTR1L_HUMAN Melatonin-related receptor OS=Homo sapiens OX=9606 GN=GPR50 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000455265

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263663	0.998	TATA box-binding protein-associated factor RNA polymerase I subunit B
2	9606.ENSP00000410409	0.990	TATA box-binding protein-associated factor RNA polymerase I subunit D
3	9606.ENSP00000375942	0.989	TATA-box-binding protein
4	9606.ENSP00000339976	0.981	TATA box-binding protein-associated factor RNA polymerase I subunit A
5	9606.ENSP00000302640	0.956	Nucleolar transcription factor 1
6	9606.ENSP00000198767	0.943	RNA polymerase I-specific transcription initiation factor RRN3
7	9606.ENSP00000296417	0.909	Histone H2A.Z
8	9606.ENSP00000333633	0.906	Metastasis-associated protein MTA1
9	9606.ENSP00000434024	0.906	Histone H2AX
10	9606.ENSP00000212015	0.905	NAD-dependent protein deacetylase sirtuin-1
11	9606.ENSP00000278823	0.903	Metastasis-associated protein MTA2
12	9606.ENSP00000364678	0.903	Histone-lysine N-methyltransferase EHMT2
13	9606.ENSP00000412302	0.903	Methyl-CpG-binding domain protein 3
14	9606.ENSP00000369716	0.902	Chromodomain-helicase-DNA-binding protein 3
15	9606.ENSP00000274764	0.901	Histone H2B type 1-A
16	9606.ENSP00000332194	0.901	Histone H2A type 2-C
17	9606.ENSP00000289316	0.900	Histone H2B type 1-D
18	9606.ENSP00000308405	0.900	Histone H2A.V
19	9606.ENSP00000324806	0.900	Glycogen synthase kinase-3 beta
20	9606.ENSP00000328484	0.900	Histone H2A type 1-J

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140223	1.000	general transcription initiation factor activity
GO:0005515	1.000	protein binding
GO:0001164	0.995	RNA polymerase I core promoter sequence-specific DNA binding
GO:0001181	0.994	RNA polymerase I general transcription initiation factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044238	0.992	primary metabolic process
GO:0006807	0.988	nitrogen compound metabolic process
GO:0044237	0.988	cellular metabolic process
GO:0043170	0.987	macromolecule metabolic process
GO:0034641	0.948	cellular nitrogen compound metabolic process
GO:1901360	0.945	organic cyclic compound metabolic process
GO:0006139	0.944	nucleobase-containing compound metabolic process
GO:0090304	0.932	nucleic acid metabolic process
GO:0006366	0.919	transcription by RNA polymerase II
GO:0006360	0.685	transcription by RNA polymerase I

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005730	1.000	nucleolus
GO:0032991	0.992	protein-containing complex
GO:0140513	0.948	nuclear protein-containing complex
GO:0005667	0.933	transcription regulator complex
GO:0001650	0.874	fibrillar center
GO:0005737	0.459	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]