StarFunc result for job id Q15573

User Input

>input (450 residues)
MSDFSEELKGPVTDDEEVETSVLSGAGMHFPWLQTYVETVAIGGKRRKDFAQTTSACLSF
IQEALLKHQWQQAAEYMYSYFQTLEDSDSYKRQAAPEIIWKLGSEILFYHPKSNMESFNT
FANRMKNIGVMNYLKISLQHALYLLHHGMLKDAKRNLSEAETWRHGENTSSREILINLIQ
AYKGLLQYYTWSEKKMELSKLDKDDYAYNAVAQDVFNHSWKTSANISALIKIPGVWDPFV
KSYVEMLEFYGDRDGAQEVLTNYAYDEKFPSNPNAHIYLYNFLKRQKAPRSKLISVLKIL
YQIVPSHKLMLEFHTLLRKSEKEEHRKLGLEVLFGVLDFAGCTKNITAWKYLAKYLKNIL
MGNHLAWVQEEWNSRKNWWPGFHFSYFWAKSDWKEDTALACEKAFVAGLLLGKGCRYFRY
ILKQDHQILGKKIKRMKRSVKKYSIVNPRL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15573	1.000	1.000	2.074E-56	450	1.000	1.000	Q15573.pdb.gz	TAF1A_HUMAN TATA box-binding protein-associated factor RNA polymerase I subunit A OS=Homo sapiens OX=9606 GN=TAF1A PE=1 SV=1
2	AFDB:P97357	0.938	0.932	7.198E-48	453	0.796	0.790	P97357.pdb.gz	TAF1A_MOUSE TATA box-binding protein-associated factor RNA polymerase I subunit A OS=Mus musculus OX=10090 GN=Taf1a PE=1 SV=1
3	AFDB:A2RUW3	0.692	0.695	1.339E-24	448	0.356	0.357	A2RUW3.pdb.gz
4	AFDB:Q5ADP3	0.289	0.146	1.230E-4	1080	0.140	0.058	Q5ADP3.pdb.gz	Q5ADP3_CANAL Transcription regulator OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SSN6 PE=1 SV=1
5	AFDB:A0A2R8PZ91	0.281	0.142	1.334E-4	1119	0.122	0.049	A0A2R8PZ91.pdb.gz
6	AFDB:O60184	0.301	0.150	3.403E-4	1102	0.116	0.047	O60184.pdb.gz	CYC8_SCHPO General transcriptional corepressor ssn6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ssn6 PE=1 SV=1
7	AFDB:A0A2R8QRB2	0.243	0.150	7.683E-4	795	0.151	0.086	A0A2R8QRB2.pdb.gz
8	AFDB:Q6NNB2	0.367	0.164	8.335E-4	1233	0.124	0.045	Q6NNB2.pdb.gz	Q6NNB2_DROME LP07472p OS=Drosophila melanogaster OX=7227 GN=SKI3 PE=1 SV=1
9	AFDB:Q61371	0.357	0.226	1.022E-3	824	0.116	0.063	Q61371.pdb.gz	IFT88_MOUSE Intraflagellar transport protein 88 homolog OS=Mus musculus OX=10090 GN=Ift88 PE=1 SV=2
10	AFDB:E7EXH4	0.251	0.224	1.304E-3	528	0.129	0.110	E7EXH4.pdb.gz	E7EXH4_DANRE Bardet-Biedl syndrome 4 OS=Danio rerio OX=7955 GN=zgc:152964 PE=4 SV=1
11	PDB:6xt9D	0.264	0.289	1.489E-3	396	0.127	0.144	6xt9D.pdb.gz
12	PDB:6yj6A	0.258	0.177	1.489E-3	819	0.111	0.061	6yj6A.pdb.gz
13	PDB:4bujB	0.362	0.143	1.550E-3	1367	0.116	0.038	4bujB.pdb.gz
14	PDB:7dkhI	0.296	0.173	1.900E-3	914	0.129	0.063	7dkhI.pdb.gz
15	PDB:7ntfA	0.264	0.159	2.237E-3	918	0.118	0.058	7ntfA.pdb.gz
16	PDB:6tedQ	0.227	0.140	2.330E-3	890	0.147	0.074	6tedQ.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.
17	PDB:5w5iC	0.272	0.279	2.527E-3	436	0.113	0.117	5w5iC.pdb.gz	Structural insights into IFIT1 dimerization and conformational changes associated with mRNA binding
18	PDB:5dseA	0.310	0.273	3.361E-3	537	0.116	0.097	5dseA.pdb.gz
19	PDB:7mq8LP	0.239	0.206	4.654E-3	567	0.138	0.109	7mq8LP.pdb.gz	Nucleolar maturation of the human small subunit processome.
20	PDB:5g05F	0.196	0.192	5.942E-3	460	0.122	0.120	5g05F.pdb.gz	Molecular Mechanism of Apc/C Activation by Mitotic Phosphorylation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P97357	0.0	749	453	0.796	0.790	TAF1A_MOUSE TATA box-binding protein-associated factor RNA polymerase I subunit A OS=Mus musculus OX=10090 GN=Taf1a PE=1 SV=1
2	Q15573	0.0	937	450	1.000	1.000	TAF1A_HUMAN TATA box-binding protein-associated factor RNA polymerase I subunit A OS=Homo sapiens OX=9606 GN=TAF1A PE=1 SV=1
3	Q5SP02	1.17e-88	279	448	0.367	0.368	Q5SP02_DANRE TATA box-binding protein (TBP)-associated factor, RNA polymerase I, A OS=Danio rerio OX=7955 GN=si:ch211-180b22.3 PE=4 SV=1
4	Q1JQ67	1.76e-88	278	448	0.367	0.368	Q1JQ67_DANRE TATA box binding protein (TBP)-associated factor, RNA polymerase I, A OS=Danio rerio OX=7955 GN=zgc:136232 PE=2 SV=1
5	Q9VU84	2.2	33.1	531	0.056	0.047	DBNL_DROME Drebrin-like protein OS=Drosophila melanogaster OX=7227 GN=Abp1 PE=1 SV=1
6	A0A0B4K7Y9	6.9	32.0	5408	0.089	0.007	A0A0B4K7Y9_DROME Short stop, isoform AA OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
7	A1Z9I9	7.1	32.0	5390	0.089	0.007	A1Z9I9_DROME Short stop, isoform B OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
8	B7YZG2	7.2	32.0	5370	0.089	0.007	B7YZG2_DROME Short stop, isoform K OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
9	A0A0B4K7P8	7.3	31.6	5394	0.089	0.007	A0A0B4K7P8_DROME Short stop, isoform Z OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
10	E1JH64	7.3	32.0	5155	0.089	0.008	E1JH64_DROME Short stop, isoform Q OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
11	A1Z9I8	7.4	31.6	5385	0.089	0.007	A1Z9I8_DROME Short stop, isoform G OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
12	E1JH62	7.4	31.6	5388	0.089	0.007	E1JH62_DROME Short stop, isoform N OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
13	Q7KJN8	7.5	31.6	5201	0.089	0.008	Q7KJN8_DROME Short stop/Kakapo long isoform OS=Drosophila melanogaster OX=7227 GN=shot PE=2 SV=1
14	A1Z9J0	7.6	31.6	5201	0.089	0.008	A1Z9J0_DROME Short stop, isoform E OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
15	A1Z9J1	7.7	31.6	5501	0.089	0.007	A1Z9J1_DROME Short stop, isoform A OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
16	B7YZG3	7.8	31.6	5375	0.089	0.007	B7YZG3_DROME Short stop, isoform I OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
17	A1Z9J2	8.0	31.6	5160	0.089	0.008	A1Z9J2_DROME Short stop, isoform C OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
18	B7YZG5	8.0	31.6	5486	0.089	0.007	B7YZG5_DROME Short stop, isoform L OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
19	B7YZG6	8.0	31.6	5479	0.089	0.007	B7YZG6_DROME Short stop, isoform M OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
20	O96936	8.1	31.6	4151	0.089	0.010	O96936_DROME Kakapo (Fragment) OS=Drosophila melanogaster OX=7227 GN=shot PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04664 OGFr_N	29	15.6	Opioid growth factor receptor (OGFr) conserved region
2	PF14929 TAF1_subA	4e-125	429.7	TAF RNA Polymerase I subunit A

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000339976

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263663	0.999	TATA box-binding protein-associated factor RNA polymerase I subunit B
2	9606.ENSP00000410409	0.996	TATA box-binding protein-associated factor RNA polymerase I subunit D
3	9606.ENSP00000375942	0.994	TATA-box-binding protein
4	9606.ENSP00000455265	0.981	TATA box-binding protein-associated factor RNA polymerase I subunit C
5	9606.ENSP00000302640	0.957	Nucleolar transcription factor 1
6	9606.ENSP00000198767	0.949	RNA polymerase I-specific transcription initiation factor RRN3
7	9606.ENSP00000332194	0.924	Histone H2A type 2-C
8	9606.ENSP00000358151	0.924	Histone H2B type 2-E
9	9606.ENSP00000465099	0.920	DNA-directed RNA polymerase I subunit RPA34
10	9606.ENSP00000367029	0.905	DNA-directed RNA polymerase I subunit RPA49
11	9606.ENSP00000362649	0.904	Histone deacetylase 1
12	9606.ENSP00000430432	0.903	Histone deacetylase 2
13	9606.ENSP00000477527	0.903	Histone H2B type 1-O
14	9606.ENSP00000477907	0.903	Histone H2B type 1-M
15	9606.ENSP00000364678	0.902	Histone-lysine N-methyltransferase EHMT2
16	9606.ENSP00000482674	0.902	Histone H2B type 1-B
17	9606.ENSP00000212015	0.901	NAD-dependent protein deacetylase sirtuin-1
18	9606.ENSP00000367022	0.901	Histone H2A type 1-C
19	9606.ENSP00000483903	0.901	Histone H2B type 1-N
20	9606.ENSP00000274764	0.900	Histone H2B type 1-A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0090304	0.996	nucleic acid metabolic process
GO:0006360	0.986	transcription by RNA polymerase I
GO:0006366	0.979	transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	1.000	intracellular non-membrane-bounded organelle
GO:0005654	1.000	nucleoplasm
GO:0032991	0.962	protein-containing complex
GO:0005730	0.744	nucleolus
GO:0005737	0.702	cytoplasm
GO:0015630	0.625	microtubule cytoskeleton
GO:0005667	0.606	transcription regulator complex
GO:0140513	0.546	nuclear protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]