StarFunc result for job id Q15596

User Input

>input (1464 residues)
MSGMGENTSDPSRAETRKRKECPDQLGPSPKRNTEKRNREQENKYIEELAELIFANFNDI
DNFNFKPDKCAILKETVKQIRQIKEQEKAAAANIDEVQKSDVSSTGQGVIDKDALGPMML
EALDGFFFVVNLEGNVVFVSENVTQYLRYNQEELMNKSVYSILHVGDHTEFVKNLLPKSI
VNGGSWSGEPPRRNSHTFNCRMLVKPLPDSEEEGHDNQEAHQKYETMQCFAVSQPKSIKE
EGEDLQSCLICVARRVPMKERPVLPSSESFTTRQDLQGKITSLDTSTMRAAMKPGWEDLV
RRCIQKFHAQHEGESVSYAKRHHHEVLRQGLAFSQIYRFSLSDGTLVAAQTKSKLIRSQT
TNEPQLVISLHMLHREQNVCVMNPDLTGQTMGKPLNPISSNSPAHQALCSGNPGQDMTLS
SNINFPINGPKEQMGMPMGRFGGSGGMNHVSGMQATTPQGSNYALKMNSPSQSSPGMNPG
QPTSMLSPRHRMSPGVAGSPRIPPSQFSPAGSLHSPVGVCSSTGNSHSYTNSSLNALQAL
SEGHGVSLGSSLASPDLKMGNLQNSPVNMNPPPLSKMGSLDSKDCFGLYGEPSEGTTGQA
ESSCHPGEQKETNDPNLPPAVSSERADGQSRLHDSKGQTKLLQLLTTKSDQMEPSPLASS
LSDTNKDSTGSLPGSGSTHGTSLKEKHKILHRLLQDSSSPVDLAKLTAEATGKDLSQESS
STAPGSEVTIKQEPVSPKKKENALLRYLLDKDDTKDIGLPEITPKLERLDSKTDPASNTK
LIAMKTEKEEMSFEPGDQPGSELDNLEEILDDLQNSQLPQLFPDTRPGAPAGSVDKQAII
NDLMQLTAENSPVTPVGAQKTALRISQSTFNNPRPGQLGRLLPNQNLPLDITLQSPTGAG
PFPPIRNSSPYSVIPQPGMMGNQGMIGNQGNLGNSSTGMIGNSASRPTMPSGEWAPQSSA
VRVTCAATTSAMNRPVQGGMIRNPAASIPMRPSSQPGQRQTLQSQVMNIGPSELEMNMGG
PQYSQQQAPPNQTAPWPESILPIDQASFASQNRQPFGSSPDDLLCPHPAAESPSDEGALL
DQLYLALRNFDGLEEIDRALGIPELVSQSQAVDPEQFSSQDSNIMLEQKAPVFPQQYASQ
AQMAQGSYSPMQDPNFHTMGQRPSYATLRMQPRPGLRPTGLVQNQPNQLRLQLQHRLQAQ
QNRQPLMNQISNVSNVNLTLRPGVPTQAPINAQMLAQRQREILNQHLRQRQMHQQQQVQQ
RTLMMRGQGLNMTPSMVAPSGMPATMSNPRIPQANAQQFPFPPNYGISQQPDPGFTGATT
PQSPLMSPRMAHTQSPMMQQSQANPAYQAPSDINGWAQGNMGGNSMFSQQSPPHFGQQAN
TSMYSNNMNINVSMATNTGGMSSMNQMTGQISMTSVTSVPTSGLSSMGPEQVNDPALRGG
NLFPNQLPGMDMIKQEGDTTRKYC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q98TW1	0.302	0.294	0.000	1505	0.606	0.589	Q98TW1.pdb.gz	NCOA2_DANRE Nuclear receptor coactivator 2 OS=Danio rerio OX=7955 GN=ncoa2 PE=1 SV=1
2	AFDB:Q9W705	0.296	0.287	0.000	1516	0.723	0.698	Q9W705.pdb.gz	NCOA2_XENLA Nuclear receptor coactivator 2 OS=Xenopus laevis OX=8355 GN=ncoa2 PE=2 SV=1
3	AFDB:Q9WUI9	0.386	0.386	0.000	1465	0.929	0.928	Q9WUI9.pdb.gz	NCOA2_RAT Nuclear receptor coactivator 2 OS=Rattus norvegicus OX=10116 GN=Ncoa2 PE=1 SV=1
4	AFDB:Q9Y6Q9	0.206	0.210	1.105E-82	1424	0.428	0.440	Q9Y6Q9.pdb.gz	NCOA3_HUMAN Nuclear receptor coactivator 3 OS=Homo sapiens OX=9606 GN=NCOA3 PE=1 SV=1
5	AFDB:O57539	0.211	0.219	1.080E-78	1391	0.432	0.454	O57539.pdb.gz	NCOA3_XENLA Nuclear receptor coactivator 3 OS=Xenopus laevis OX=8355 GN=ncoa3 PE=1 SV=1
6	AFDB:O09000	0.260	0.270	3.934E-76	1398	0.419	0.439	O09000.pdb.gz	NCOA3_MOUSE Nuclear receptor coactivator 3 OS=Mus musculus OX=10090 GN=Ncoa3 PE=1 SV=2
7	AFDB:P70365	0.254	0.257	9.637E-64	1447	0.373	0.377	P70365.pdb.gz	NCOA1_MOUSE Nuclear receptor coactivator 1 OS=Mus musculus OX=10090 GN=Ncoa1 PE=1 SV=2
8	AFDB:D4A3Q3	0.097	0.100	7.173E-47	1417	0.351	0.363	D4A3Q3.pdb.gz	D4A3Q3_RAT Nuclear receptor coactivator OS=Rattus norvegicus OX=10116 GN=Ncoa1 PE=1 SV=2
9	AFDB:M9ND53	0.122	0.096	7.170E-22	2047	0.174	0.125	M9ND53.pdb.gz	M9ND53_DROME Taiman, isoform G OS=Drosophila melanogaster OX=7227 GN=tai PE=1 SV=1
10	AFDB:Q99814	0.103	0.161	4.021E-20	870	0.103	0.174	Q99814.pdb.gz	EPAS1_HUMAN Endothelial PAS domain-containing protein 1 OS=Homo sapiens OX=9606 GN=EPAS1 PE=1 SV=3
11	PDB:6umzA	0.063	0.538	6.566E-4	127	0.012	0.134	6umzA.pdb.gz	Structural and spectroscopic characterization of photoactive yellow protein and photoswitchable fluorescent protein constructs containing heavy atoms.
12	PDB:2wkpA	0.064	0.265	7.109E-3	320	0.018	0.084	2wkpA.pdb.gz	A Genetically Encoded Photoactivatable Rac Controls the Motility of Living Cells.
13	PDB:7rzwB	0.065	0.106	1.864E-2	864	0.019	0.032	7rzwB.pdb.gz	Plant phytochrome B is an asymmetric dimer with unique signalling potential.
14	PDB:7d9tA	0.033	0.081	3.479E-2	512	0.009	0.025	7d9tA.pdb.gz	Activation mechanism of human soluble guanylate cyclase by stimulators and activators.
15	PDB:3ve1A	0.035	0.075	5.476E-2	537	0.011	0.030	3ve1A.pdb.gz	The structural basis of transferrin sequestration by transferrin-binding protein B.
16	PDB:6jt0A	0.032	0.068	5.796E-2	542	0.013	0.035	6jt0A.pdb.gz	Structural insights into the mechanism of human soluble guanylate cyclase.
17	PDB:3ggrB	0.032	0.092	8.145E-2	278	0.016	0.086	3ggrB.pdb.gz
18	PDB:3omlA	0.043	0.087	1.022E-1	532	0.023	0.062	3omlA.pdb.gz
19	PDB:1lo7A	0.026	0.132	1.211E-1	140	0.009	0.093	1lo7A.pdb.gz	X-ray crystallographic analyses of inhibitor and substrate complexes of wild-type and mutant 4-hydroxybenzoyl-CoA thioesterase.
20	PDB:2bi0A	0.027	0.072	1.282E-1	330	0.016	0.073	2bi0A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O09000	0.0	830	1398	0.418	0.438	NCOA3_MOUSE Nuclear receptor coactivator 3 OS=Mus musculus OX=10090 GN=Ncoa3 PE=1 SV=2
2	O57539	0.0	887	1391	0.435	0.458	NCOA3_XENLA Nuclear receptor coactivator 3 OS=Xenopus laevis OX=8355 GN=ncoa3 PE=1 SV=1
3	Q15596	0.0	2999	1464	1.000	1.000	NCOA2_HUMAN Nuclear receptor coactivator 2 OS=Homo sapiens OX=9606 GN=NCOA2 PE=1 SV=2
4	Q61026	0.0	2800	1462	0.939	0.940	NCOA2_MOUSE Nuclear receptor coactivator 2 OS=Mus musculus OX=10090 GN=Ncoa2 PE=1 SV=3
5	Q7TPU7	0.0	2523	1393	0.867	0.912	Q7TPU7_MOUSE Nuclear receptor coactivator OS=Mus musculus OX=10090 GN=Ncoa2 PE=2 SV=1
6	Q98TW1	0.0	1449	1505	0.596	0.580	NCOA2_DANRE Nuclear receptor coactivator 2 OS=Danio rerio OX=7955 GN=ncoa2 PE=1 SV=1
7	Q9W705	0.0	1952	1516	0.714	0.689	NCOA2_XENLA Nuclear receptor coactivator 2 OS=Xenopus laevis OX=8355 GN=ncoa2 PE=2 SV=1
8	Q9WUI9	0.0	2739	1465	0.929	0.928	NCOA2_RAT Nuclear receptor coactivator 2 OS=Rattus norvegicus OX=10116 GN=Ncoa2 PE=1 SV=1
9	Q9Y6Q9	0.0	917	1424	0.434	0.447	NCOA3_HUMAN Nuclear receptor coactivator 3 OS=Homo sapiens OX=9606 GN=NCOA3 PE=1 SV=1
10	Q15788	6.36e-178	572	1441	0.260	0.264	NCOA1_HUMAN Nuclear receptor coactivator 1 OS=Homo sapiens OX=9606 GN=NCOA1 PE=1 SV=3
11	P70365	3.38e-173	559	1447	0.259	0.262	NCOA1_MOUSE Nuclear receptor coactivator 1 OS=Mus musculus OX=10090 GN=Ncoa1 PE=1 SV=2
12	A0A8I6GLM3	1.36e-171	555	1443	0.259	0.263	A0A8I6GLM3_RAT Nuclear receptor coactivator OS=Rattus norvegicus OX=10116 GN=Ncoa1 PE=1 SV=1
13	A0A8I6APA0	2.78e-171	554	1460	0.259	0.260	A0A8I6APA0_RAT Nuclear receptor coactivator OS=Rattus norvegicus OX=10116 GN=Ncoa1 PE=1 SV=1
14	Q9EPU2	1.27e-153	497	1082	0.298	0.403	NCOA3_RAT Nuclear receptor coactivator 3 (Fragment) OS=Rattus norvegicus OX=10116 GN=Ncoa3 PE=2 SV=1
15	A0A0G2JZG4	1.00e-132	447	1401	0.232	0.243	A0A0G2JZG4_RAT Nuclear receptor coactivator OS=Rattus norvegicus OX=10116 GN=Ncoa1 PE=1 SV=2
16	D4A3Q3	1.12e-132	447	1417	0.232	0.240	D4A3Q3_RAT Nuclear receptor coactivator OS=Rattus norvegicus OX=10116 GN=Ncoa1 PE=1 SV=2
17	B5MCN7	7.75e-110	380	1248	0.195	0.228	B5MCN7_HUMAN Nuclear receptor coactivator 1 OS=Homo sapiens OX=9606 GN=NCOA1 PE=1 SV=1
18	Q8QGQ6	6.86e-20	99.0	875	0.065	0.109	CLOCK_CHICK Circadian locomoter output cycles protein kaput OS=Gallus gallus OX=9031 GN=CLOCK PE=1 SV=2
19	Q91YB0	1.27e-19	98.2	865	0.065	0.110	CLOCK_NANGA Circadian locomoter output cycles protein kaput OS=Nannospalax galili OX=1026970 GN=Clock PE=1 SV=1
20	Q9WVS9	1.61e-19	97.8	862	0.058	0.099	CLOCK_RAT Circadian locomoter output cycles protein kaput OS=Rattus norvegicus OX=10116 GN=Clock PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07469 DUF1518	4.5e-22	89.5	Nuclear receptor coactivator, DUF1518
2	PF16279 DUF4927	1.5e-27	107.7	Domain of unknown function (DUF4927)
3	PF00010 HLH	54	15.2	Helix-loop-helix DNA-binding domain
4	PF16665 NCOA_u2	2.8e-34	129.4	Unstructured region on nuclear receptor coactivator protein
5	PF08815 Nuc_rec_co-act	5.5e-21	85.5	Nuclear receptor coactivator
6	PF00989 PAS	0.00028	32.2	PAS fold
7	PF14598 PAS_11	1.6e-29	113.6	PAS domain
8	PF08447 PAS_3	0.00047	31.7	PAS fold
9	PF13426 PAS_9	0.21	23.3	PAS domain
10	PF08832 SRC-1	1.7e-15	69.0	Steroid receptor coactivator

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000399968

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000231509	0.999	Glucocorticoid receptor
2	9606.ENSP00000287820	0.999	Peroxisome proliferator-activated receptor gamma
3	9606.ENSP00000343925	0.999	Estrogen receptor beta
4	9606.ENSP00000363822	0.999	Androgen receptor
5	9606.ENSP00000405330	0.999	Estrogen receptor
6	9606.ENSP00000419692	0.999	Retinoic acid receptor RXR-alpha
7	9606.ENSP00000262367	0.998	CREB-binding protein
8	9606.ENSP00000254066	0.997	Retinoic acid receptor alpha
9	9606.ENSP00000325690	0.995	Histone-arginine methyltransferase CARM1
10	9606.ENSP00000263253	0.993	Histone acetyltransferase p300
11	9606.ENSP00000344456	0.987	Catenin beta-1
12	9606.ENSP00000379904	0.987	Thyroid hormone receptor beta
13	9606.ENSP00000385216	0.986	Nuclear receptor coactivator 1
14	9606.ENSP00000380136	0.980	Histone acetyltransferase KAT6A
15	9606.ENSP00000352900	0.968	Retinoic acid receptor RXR-gamma
16	9606.ENSP00000447173	0.966	Vitamin D3 receptor
17	9606.ENSP00000340874	0.964	Myocyte-specific enhancer factor 2C
18	9606.ENSP00000300651	0.963	Mediator of RNA polymerase II transcription subunit 1
19	9606.ENSP00000356331	0.958	Nuclear receptor subfamily 5 group A member 2
20	9606.ENSP00000361066	0.953	Nuclear receptor coactivator 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016922	1.000	nuclear receptor binding
GO:0005102	0.999	signaling receptor binding
GO:0003713	0.999	transcription coactivator activity
GO:0019899	0.992	enzyme binding
GO:0030331	0.990	nuclear estrogen receptor binding
GO:0046965	0.989	nuclear retinoid X receptor binding
GO:0030374	0.987	nuclear receptor coactivator activity
GO:0044877	0.985	protein-containing complex binding
GO:0046966	0.977	nuclear thyroid hormone receptor binding
GO:0003676	0.947	nucleic acid binding
GO:0003677	0.939	DNA binding
GO:0043565	0.855	sequence-specific DNA binding
GO:0070182	0.820	DNA polymerase binding
GO:0035259	0.807	nuclear glucocorticoid receptor binding
GO:1990837	0.807	sequence-specific double-stranded DNA binding
GO:0000976	0.769	transcription cis-regulatory region binding
GO:0000977	0.657	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0033142	0.449	nuclear progesterone receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048518	0.998	positive regulation of biological process
GO:0006355	0.996	regulation of DNA-templated transcription
GO:0050896	0.992	response to stimulus
GO:0048522	0.988	positive regulation of cellular process
GO:0010604	0.988	positive regulation of macromolecule metabolic process
GO:0051173	0.986	positive regulation of nitrogen compound metabolic process
GO:0031325	0.984	positive regulation of cellular metabolic process
GO:0006357	0.982	regulation of transcription by RNA polymerase II
GO:0009987	0.980	cellular process
GO:0031328	0.967	positive regulation of cellular biosynthetic process
GO:0051254	0.967	positive regulation of RNA metabolic process
GO:0010557	0.965	positive regulation of macromolecule biosynthetic process
GO:0045893	0.964	positive regulation of DNA-templated transcription
GO:0010033	0.955	response to organic substance
GO:0045944	0.927	positive regulation of transcription by RNA polymerase II
GO:0032501	0.835	multicellular organismal process
GO:0014070	0.762	response to organic cyclic compound
GO:0051716	0.702	cellular response to stimulus
GO:0033993	0.672	response to lipid
GO:0048583	0.596	regulation of response to stimulus
GO:0009966	0.523	regulation of signal transduction
GO:0048519	0.495	negative regulation of biological process
GO:0048856	0.439	anatomical structure development
GO:0048523	0.429	negative regulation of cellular process
GO:0007154	0.418	cell communication
GO:0009892	0.371	negative regulation of metabolic process
GO:0031324	0.355	negative regulation of cellular metabolic process
GO:1901700	0.348	response to oxygen-containing compound
GO:0009719	0.346	response to endogenous stimulus
GO:0071704	0.337	organic substance metabolic process
GO:0070887	0.326	cellular response to chemical stimulus
GO:0010605	0.316	negative regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005667	0.995	transcription regulator complex
GO:0005737	0.974	cytoplasm
GO:0140513	0.932	nuclear protein-containing complex
GO:0090575	0.823	RNA polymerase II transcription regulator complex
GO:0120025	0.396	plasma membrane bounded cell projection
GO:0043005	0.394	neuron projection
GO:0043197	0.340	dendritic spine

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]