StarFunc result for job id Q15628

User Input

>input (312 residues)
MAAGQNGHEEWVGSAYLFVESSLDKVVLSDAYAHPQQKVAVYRALQAALAESGGSPDVLQ
MLKIHRSDPQLIVQLRFCGRQPCGRFLRAYREGALRAALQRSLAAALAQHSVPLQLELRA
GAERLDALLADEERCLSCILAQQPDRLRDEELAELEDALRNLKCGSGARGGDGEVASAPL
QPPVPSLSEVKPPPPPPPAQTFLFQGQPVVNRPLSLKDQQTFARSVGLKWRKVGRSLQRG
CRALRDPALDSLAYEYEREGLYEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAED
LLGLTDPNGGLA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15628	1.000	1.000	6.899E-53	312	1.000	1.000	Q15628.pdb.gz	TRADD_HUMAN Tumor necrosis factor receptor type 1-associated DEATH domain protein OS=Homo sapiens OX=9606 GN=TRADD PE=1 SV=2
2	AFDB:D3ZZC5	0.802	0.807	1.221E-44	310	0.769	0.774	D3ZZC5.pdb.gz	D3ZZC5_RAT Tumor necrosis factor receptor type 1-associated DEATH domain protein OS=Rattus norvegicus OX=10116 GN=Tradd PE=4 SV=1
3	AFDB:Q9I9N5	0.505	0.536	2.788E-26	293	0.385	0.410	Q9I9N5.pdb.gz	TRADD_DANRE Tumor necrosis factor receptor type 1-associated DEATH domain protein OS=Danio rerio OX=7955 GN=tradd PE=2 SV=1
4	AFDB:Q8R3N6	0.267	0.132	9.920E-5	657	0.125	0.059	Q8R3N6.pdb.gz	THOC1_MOUSE THO complex subunit 1 OS=Mus musculus OX=10090 GN=Thoc1 PE=1 SV=1
5	AFDB:F4K4L3	0.201	0.111	5.599E-3	631	0.074	0.036	F4K4L3.pdb.gz	F4K4L3_ARATH Eukaryotic aspartyl protease family protein OS=Arabidopsis thaliana OX=3702 GN=MMG4.12 PE=1 SV=1
6	AFDB:Q13546	0.270	0.127	7.605E-3	671	0.080	0.037	Q13546.pdb.gz	RIPK1_HUMAN Receptor-interacting serine/threonine-protein kinase 1 OS=Homo sapiens OX=9606 GN=RIPK1 PE=1 SV=3
7	AFDB:P19438	0.238	0.168	9.328E-3	455	0.122	0.084	P19438.pdb.gz	TNR1A_HUMAN Tumor necrosis factor receptor superfamily member 1A OS=Homo sapiens OX=9606 GN=TNFRSF1A PE=1 SV=1
8	AFDB:Q9VNI8	0.253	0.116	9.328E-3	701	0.106	0.047	Q9VNI8.pdb.gz	Q9VNI8_DROME Hpr1 OS=Drosophila melanogaster OX=7227 GN=Hpr1 PE=1 SV=1
9	AFDB:P16157	0.258	0.045	1.204E-2	1881	0.077	0.013	P16157.pdb.gz	ANK1_HUMAN Ankyrin-1 OS=Homo sapiens OX=9606 GN=ANK1 PE=1 SV=3
10	AFDB:Q0KIE7	0.255	0.056	1.204E-2	1549	0.080	0.016	Q0KIE7.pdb.gz	Q0KIE7_DROME Ankyrin, isoform B OS=Drosophila melanogaster OX=7227 GN=Ank PE=1 SV=1
11	PDB:1xmbA	0.196	0.167	3.151E-2	375	0.022	0.019	1xmbA.pdb.gz
12	PDB:1kb9A	0.179	0.140	7.897E-2	431	0.032	0.023	1kb9A.pdb.gz	SPECIFIC ROLES OF PROTEIN-PHOSPHOLIPID INTERACTIONS IN THE YEAST CYTOCHROME BC1 COMPLEX STRUCTURE
13	PDB:4pydC	0.182	0.307	8.311E-2	154	0.051	0.104	4pydC.pdb.gz	Mechanism of pyranopterin ring formation in molybdenum cofactor biosynthesis.
14	PDB:7rjaB	0.152	0.137	1.129E-1	364	0.038	0.033	7rjaB.pdb.gz	Rieske head domain dynamics and indazole-derivative inhibition of Candida albicans complex III.
15	PDB:5d6vA	0.175	0.434	1.188E-1	90	0.061	0.211	5d6vA.pdb.gz
16	PDB:6ofsA	0.150	0.066	1.250E-1	905	0.061	0.021	6ofsA.pdb.gz	Protease-associated import systems are widespread in Gram-negative bacteria.
17	PDB:4pxbA	0.151	0.121	1.385E-1	423	0.058	0.043	4pxbA.pdb.gz	Structural insights into the substrate specificity of (s)-ureidoglycolate amidohydrolase and its comparison with allantoate amidohydrolase.
18	PDB:2xmaE	0.221	0.408	1.534E-1	141	0.061	0.135	2xmaE.pdb.gz	DNA Recognition and the Precleavage State During Single-Stranded DNA Transposition in D. Radiodurans.
19	PDB:1q8kA	0.203	0.210	1.787E-1	300	0.042	0.043	1q8kA.pdb.gz
20	PDB:4pxdA	0.209	0.167	1.980E-1	411	0.061	0.046	4pxdA.pdb.gz	Structural insights into the substrate specificity of (s)-ureidoglycolate amidohydrolase and its comparison with allantoate amidohydrolase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q15628	0.0	617	312	1.000	1.000	TRADD_HUMAN Tumor necrosis factor receptor type 1-associated DEATH domain protein OS=Homo sapiens OX=9606 GN=TRADD PE=1 SV=2
2	D3ZZC5	2.14e-158	446	310	0.769	0.774	D3ZZC5_RAT Tumor necrosis factor receptor type 1-associated DEATH domain protein OS=Rattus norvegicus OX=10116 GN=Tradd PE=4 SV=1
3	Q3U0V2	8.05e-158	444	310	0.766	0.771	TRADD_MOUSE Tumor necrosis factor receptor type 1-associated DEATH domain protein OS=Mus musculus OX=10090 GN=Tradd PE=1 SV=1
4	Q9I9N5	1.06e-66	212	293	0.407	0.433	TRADD_DANRE Tumor necrosis factor receptor type 1-associated DEATH domain protein OS=Danio rerio OX=7955 GN=tradd PE=2 SV=1
5	D3ZYL0	2.81e-05	47.8	658	0.103	0.049	D3ZYL0_RAT Receptor interacting serine/threonine kinase 1 OS=Rattus norvegicus OX=10116 GN=Ripk1 PE=1 SV=1
6	Q13546	7.17e-05	46.6	671	0.087	0.040	RIPK1_HUMAN Receptor-interacting serine/threonine-protein kinase 1 OS=Homo sapiens OX=9606 GN=RIPK1 PE=1 SV=3
7	Q60855	8.88e-05	46.2	656	0.077	0.037	RIPK1_MOUSE Receptor-interacting serine/threonine-protein kinase 1 OS=Mus musculus OX=10090 GN=Ripk1 PE=1 SV=1
8	Q0MSH9	0.001	42.7	661	0.083	0.039	Q0MSH9_DANRE Receptor-interacting protein 1 OS=Danio rerio OX=7955 GN=rip1 PE=2 SV=1
9	Q8R3N6	0.019	38.9	657	0.090	0.043	THOC1_MOUSE THO complex subunit 1 OS=Mus musculus OX=10090 GN=Thoc1 PE=1 SV=1
10	Q96FV9	0.10	36.6	657	0.087	0.041	THOC1_HUMAN THO complex subunit 1 OS=Homo sapiens OX=9606 GN=THOC1 PE=1 SV=1
11	Q382G7	0.56	34.3	754	0.189	0.078	Q382G7_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.5270 PE=4 SV=1
12	G8IHU0	2.1	32.7	3078	0.045	0.005	G8IHU0_DANRE Laminin alpha 2 chain short splice variant OS=Danio rerio OX=7955 GN=Lama2 PE=1 SV=1
13	P9WPU7	2.4	32.3	549	0.071	0.040	ATPA_MYCTU ATP synthase subunit alpha OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=atpA PE=1 SV=1
14	C7DZJ6	3.9	32.0	1171	0.054	0.015	C7DZJ6_DANRE Basonuclin-2 OS=Danio rerio OX=7955 GN=bnp PE=2 SV=1
15	F1R425	3.9	32.0	978	0.054	0.017	F1R425_DANRE Basonuclin 2 OS=Danio rerio OX=7955 GN=bnp PE=4 SV=2
16	A0A0R4IKC9	4.1	31.6	1268	0.054	0.013	A0A0R4IKC9_DANRE Basonuclin 2 OS=Danio rerio OX=7955 GN=bnp PE=4 SV=1
17	A0A2R8QKL6	4.1	32.0	1223	0.054	0.014	A0A2R8QKL6_DANRE Basonuclin 2 OS=Danio rerio OX=7955 GN=bnp PE=4 SV=1
18	B0S6L0	7.3	30.8	1578	0.051	0.010	B0S6L0_DANRE [histone H3]-trimethyl-L-lysine(4) demethylase OS=Danio rerio OX=7955 GN=im:7158173 PE=1 SV=1
19	Q382W3	8.4	30.8	916	0.090	0.031	Q382W3_TRYB2 Kinesin-like protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.3990 PE=3 SV=1
20	O62683	8.8	30.8	898	0.071	0.024	ZO3_CANLF Tight junction protein ZO-3 OS=Canis lupus familiaris OX=9615 GN=TJP3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00531 Death	0.00028	32.3	Death domain
2	PF09034 TRADD_N	8.5e-41	149.9	TRADD, N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000341268

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000162749	0.999	Tumor necrosis factor receptor superfamily member 1A
2	9606.ENSP00000247668	0.999	TNF receptor-associated factor 2
3	9606.ENSP00000259808	0.999	Receptor-interacting serine/threonine-protein kinase 1
4	9606.ENSP00000301838	0.999	FAS-associated death domain protein
5	9606.ENSP00000351273	0.999	Caspase-8
6	9606.ENSP00000398698	0.999	Tumor necrosis factor
7	9606.ENSP00000477613	0.999	Baculoviral IAP repeat-containing protein 2
8	9606.ENSP00000261464	0.997	TNF receptor-associated factor 5
9	9606.ENSP00000354394	0.997	Signal transducer and activator of transcription 1-alpha/beta
10	9606.ENSP00000401980	0.997	Mitochondrial antiviral-signaling protein
11	9606.ENSP00000362994	0.996	TNF receptor-associated factor 1
12	9606.ENSP00000367013	0.995	Tumor necrosis factor receptor superfamily member 25
13	9606.ENSP00000216274	0.992	Receptor-interacting serine/threonine-protein kinase 3
14	9606.ENSP00000263464	0.992	Baculoviral IAP repeat-containing protein 3
15	9606.ENSP00000454207	0.991	TNF receptor-associated factor 3
16	9606.ENSP00000276431	0.990	Tumor necrosis factor receptor superfamily member 10B
17	9606.ENSP00000376505	0.988	TRAF family member-associated NF-kappa-B activator
18	9606.ENSP00000433623	0.988	TNF receptor-associated factor 6
19	9606.ENSP00000221132	0.987	Tumor necrosis factor receptor superfamily member 10A
20	9606.ENSP00000286186	0.985	Caspase-10

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	1.000	signaling receptor binding
GO:0019899	0.994	enzyme binding
GO:0042802	0.986	identical protein binding
GO:0019900	0.972	kinase binding
GO:0019901	0.949	protein kinase binding
GO:0019904	0.947	protein domain specific binding
GO:0030159	0.932	signaling receptor complex adaptor activity
GO:1990782	0.909	protein tyrosine kinase binding
GO:0005068	0.882	transmembrane receptor protein tyrosine kinase adaptor activity
GO:0070513	0.656	death domain binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0007165	0.989	signal transduction
GO:0007166	0.984	cell surface receptor signaling pathway
GO:0048522	0.980	positive regulation of cellular process
GO:0012501	0.977	programmed cell death
GO:0006915	0.974	apoptotic process
GO:0019222	0.942	regulation of metabolic process
GO:0043122	0.929	regulation of I-kappaB kinase/NF-kappaB signaling
GO:0051090	0.926	regulation of DNA-binding transcription factor activity
GO:0097190	0.908	apoptotic signaling pathway
GO:0034097	0.896	response to cytokine
GO:0048584	0.888	positive regulation of response to stimulus
GO:0010941	0.870	regulation of cell death
GO:0071345	0.841	cellular response to cytokine stimulus
GO:0019221	0.819	cytokine-mediated signaling pathway
GO:0009967	0.799	positive regulation of signal transduction
GO:0034612	0.797	response to tumor necrosis factor
GO:0097191	0.783	extrinsic apoptotic signaling pathway
GO:0044093	0.780	positive regulation of molecular function
GO:0043123	0.778	positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0071356	0.774	cellular response to tumor necrosis factor
GO:0043067	0.722	regulation of programmed cell death
GO:0051091	0.707	positive regulation of DNA-binding transcription factor activity
GO:0042981	0.700	regulation of apoptotic process
GO:0043065	0.678	positive regulation of apoptotic process
GO:1901222	0.666	regulation of NIK/NF-kappaB signaling
GO:0033209	0.659	tumor necrosis factor-mediated signaling pathway
GO:0032101	0.597	regulation of response to external stimulus
GO:0080134	0.574	regulation of response to stress
GO:0051092	0.558	positive regulation of NF-kappaB transcription factor activity
GO:0031347	0.475	regulation of defense response
GO:0009893	0.349	positive regulation of metabolic process
GO:0051239	0.345	regulation of multicellular organismal process
GO:0010604	0.338	positive regulation of macromolecule metabolic process
GO:0031349	0.322	positive regulation of defense response

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005737	1.000	cytoplasm
GO:0032991	0.998	protein-containing complex
GO:0005886	0.988	plasma membrane
GO:0005829	0.985	cytosol
GO:0043231	0.817	intracellular membrane-bounded organelle
GO:0098796	0.731	membrane protein complex
GO:0005634	0.713	nucleus
GO:0043235	0.551	receptor complex
GO:0098797	0.517	plasma membrane protein complex
GO:0012505	0.384	endomembrane system
GO:0070013	0.333	intracellular organelle lumen
GO:0031981	0.319	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]