StarFunc result for job id Q15633

User Input

>input (366 residues)
MSEEEQGSGTTTGCGLPSIEQMLAANPGKTPISLLQEYGTRIGKTPVYDLLKAEGQAHQP
NFTFRVTVGDTSCTGQGPSKKAAKHKAAEVALKHLKGGSMLEPALEDSSSFSPLDSSLPE
DIPVFTAAAAATPVPSVVLTRSPPMELQPPVSPQQSECNPVGALQELVVQKGWRLPEYTV
TQESGPAHRKEFTMTCRVERFIEIGSGTSKKLAKRNAAAKMLLRVHTVPLDARDGNEVEP
DDDHFSIGVGSRLDGLRNRGPGCTWDSLRNSVGEKILSLRSCSLGSLGALGPACCRVLSE
LSEEQAFHVSYLDIEELSLSGLCQCLVELSTQPATVCHGSATTREAARGEAARRALQYLK
IMAGSK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15633	1.000	1.000	2.831E-65	366	1.000	1.000	Q15633.pdb.gz	TRBP2_HUMAN RISC-loading complex subunit TARBP2 OS=Homo sapiens OX=9606 GN=TARBP2 PE=1 SV=3
2	PDB:7zpkC	0.228	0.356	4.595E-38	233	0.617	0.970	7zpkC.pdb.gz	Structural and functional basis of mammalian microRNA biogenesis by Dicer.
3	AFDB:O75569	0.370	0.423	6.124E-36	313	0.410	0.479	O75569.pdb.gz	PRKRA_HUMAN Interferon-inducible double-stranded RNA-dependent protein kinase activator A OS=Homo sapiens OX=9606 GN=PRKRA PE=1 SV=1
4	AFDB:Q9VJY9	0.343	0.278	2.023E-29	465	0.344	0.271	Q9VJY9.pdb.gz	LOQS_DROME Protein Loquacious OS=Drosophila melanogaster OX=7227 GN=loqs PE=1 SV=2
5	AFDB:Q8IP72	0.395	0.350	5.014E-25	419	0.328	0.286	Q8IP72.pdb.gz
6	PDB:8dfvK	0.356	0.505	3.541E-22	253	0.292	0.423	8dfvK.pdb.gz	Structural basis of microRNA biogenesis by Dicer-1 and its partner protein Loqs-PB.
7	AFDB:Q6JPI2	0.218	0.120	8.619E-22	712	0.243	0.125	Q6JPI2.pdb.gz	Q6JPI2_XENLA Double-stranded RNA-binding protein Staufen homolog 1 isoform X2 OS=Xenopus laevis OX=8355 GN=Stau PE=2 SV=1
8	AFDB:Q66HP4	0.231	0.171	2.479E-21	554	0.254	0.168	Q66HP4.pdb.gz	Q66HP4_RAT Stau1 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Stau1 PE=2 SV=1
9	AFDB:O95793	0.223	0.160	1.243E-20	577	0.249	0.158	O95793.pdb.gz	STAU1_HUMAN Double-stranded RNA-binding protein Staufen homolog 1 OS=Homo sapiens OX=9606 GN=STAU1 PE=1 SV=2
10	AFDB:Q3L1C9	0.203	0.087	9.195E-20	950	0.265	0.102	Q3L1C9.pdb.gz	STAUH_APLCA Double-stranded RNA-binding protein Staufen homolog OS=Aplysia californica OX=6500 PE=1 SV=1
11	AFDB:P25159	0.200	0.085	1.149E-19	1026	0.262	0.094	P25159.pdb.gz	STAU_DROME Maternal effect protein staufen OS=Drosophila melanogaster OX=7227 GN=stau PE=1 SV=2
12	AFDB:A0A2R8Q731	0.229	0.137	1.214E-19	702	0.260	0.135	A0A2R8Q731.pdb.gz
13	PDB:8dgaK	0.254	0.494	1.116E-13	182	0.186	0.374	8dgaK.pdb.gz	Structural basis of microRNA biogenesis by Dicer-1 and its partner protein Loqs-PB.
14	PDB:7v6cB	0.264	0.348	2.247E-12	260	0.153	0.215	7v6cB.pdb.gz	Structure of the Dicer-2-R2D2 heterodimer bound to a small RNA duplex.
15	PDB:5zakB	0.192	0.877	5.392E-9	75	0.197	0.960	5zakB.pdb.gz
16	PDB:7r97A	0.192	0.305	8.294E-6	226	0.071	0.115	7r97A.pdb.gz	Structural basis for Dicer-like function of an engineered RNase III variant and insights into the reaction trajectory of two-Mg 2+ -ion catalysis.
17	PDB:1yykA	0.186	0.305	1.529E-5	221	0.060	0.100	1yykA.pdb.gz	Intermediate states of ribonuclease III in complex with double-stranded RNA
18	PDB:7l08c	0.188	0.233	1.337E-4	289	0.060	0.076	7l08c.pdb.gz	Distinct mechanisms of the human mitoribosome recycling and antibiotic resistance.
19	PDB:3j6b5	0.171	0.191	1.579E-4	326	0.060	0.067	3j6b5.pdb.gz	Structure of the yeast mitochondrial large ribosomal subunit.
20	PDB:7vg3A	0.164	0.074	5.365E-4	860	0.090	0.038	7vg3A.pdb.gz	Mechanism of siRNA production by a plant Dicer-RNA complex in dicing-competent conformation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P97473	0.0	639	365	0.937	0.940	TRBP2_MOUSE RISC-loading complex subunit TARBP2 OS=Mus musculus OX=10090 GN=Tarbp2 PE=1 SV=2
2	Q15633	0.0	748	366	1.000	1.000	TRBP2_HUMAN RISC-loading complex subunit TARBP2 OS=Homo sapiens OX=9606 GN=TARBP2 PE=1 SV=3
3	F8VZ57	3.86e-124	358	227	0.481	0.775	F8VZ57_HUMAN TARBP2 subunit of RISC loading complex (Fragment) OS=Homo sapiens OX=9606 GN=TARBP2 PE=1 SV=2
4	Q4V8C7	1.17e-87	269	313	0.440	0.514	PRKRA_RAT Interferon-inducible double-stranded RNA-dependent protein kinase activator A OS=Rattus norvegicus OX=10116 GN=Prkra PE=1 SV=1
5	Q9WTX2	6.09e-87	267	313	0.437	0.511	PRKRA_MOUSE Interferon-inducible double-stranded RNA-dependent protein kinase activator A OS=Mus musculus OX=10090 GN=Prkra PE=1 SV=1
6	O75569	2.34e-86	265	313	0.432	0.505	PRKRA_HUMAN Interferon-inducible double-stranded RNA-dependent protein kinase activator A OS=Homo sapiens OX=9606 GN=PRKRA PE=1 SV=1
7	X2J5X6	4.07e-50	176	464	0.331	0.261	X2J5X6_DROME Loquacious, isoform F OS=Drosophila melanogaster OX=7227 GN=loqs PE=1 SV=1
8	Q9VJY9	6.27e-49	173	465	0.328	0.258	LOQS_DROME Protein Loquacious OS=Drosophila melanogaster OX=7227 GN=loqs PE=1 SV=2
9	X2JAB1	5.25e-46	164	418	0.311	0.273	X2JAB1_DROME Loquacious, isoform E OS=Drosophila melanogaster OX=7227 GN=loqs PE=1 SV=1
10	Q7ZW47	4.90e-15	78.6	606	0.169	0.102	STAU2_DANRE Double-stranded RNA-binding protein Staufen homolog 2 OS=Danio rerio OX=7955 GN=stau2 PE=2 SV=2
11	Q9NUL3	3.59e-14	75.9	570	0.156	0.100	STAU2_HUMAN Double-stranded RNA-binding protein Staufen homolog 2 OS=Homo sapiens OX=9606 GN=STAU2 PE=1 SV=2
12	Q68SB1	4.23e-14	75.9	571	0.153	0.098	STAU2_RAT Double-stranded RNA-binding protein Staufen homolog 2 OS=Rattus norvegicus OX=10116 GN=Stau2 PE=1 SV=1
13	O95793	1.02e-13	74.7	577	0.158	0.101	STAU1_HUMAN Double-stranded RNA-binding protein Staufen homolog 1 OS=Homo sapiens OX=9606 GN=STAU1 PE=1 SV=2
14	Q9ESY8	2.12e-12	70.5	489	0.161	0.121	Q9ESY8_RAT Stau1 protein OS=Rattus norvegicus OX=10116 GN=Stau1 PE=2 SV=1
15	Q66HP4	2.35e-12	70.5	554	0.161	0.106	Q66HP4_RAT Stau1 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Stau1 PE=2 SV=1
16	Q9ET50	2.44e-12	70.1	495	0.156	0.115	Q9ET50_RAT Staufen double-stranded RNA binding protein 1 OS=Rattus norvegicus OX=10116 GN=Stau1 PE=1 SV=1
17	F1MUM9	2.68e-12	70.5	1149	0.180	0.057	F1MUM9_BOVIN Adenosine deaminase RNA specific OS=Bos taurus OX=9913 GN=ADAR PE=1 SV=3
18	Q5JW30	3.55e-12	69.7	494	0.161	0.119	Q5JW30_HUMAN Staufen double-stranded RNA binding protein 1 OS=Homo sapiens OX=9606 GN=STAU1 PE=1 SV=1
19	F1Q5V4	1.09e-11	68.6	690	0.172	0.091	F1Q5V4_DANRE Double-stranded RNA-binding protein Staufen homolog 1 isoform X2 OS=Danio rerio OX=7955 GN=fi67e05 PE=1 SV=1
20	Q6JPI2	2.24e-11	67.4	712	0.164	0.084	Q6JPI2_XENLA Double-stranded RNA-binding protein Staufen homolog 1 isoform X2 OS=Xenopus laevis OX=8355 GN=Stau PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14709 DND1_DSRM	2.6e-07	42.2	double strand RNA binding domain from DEAD END PROTEIN 1
2	PF00035 dsrm	1.5e-30	117.0	Double-stranded RNA binding motif
3	PF16482 Staufen_C	1.2	20.7	Staufen C-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000021465

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000021032	0.999	Dicer 1, ribonuclease type III
2	61853.ENSNLEP00000001761	0.997	Protein argonaute-2
3	61853.ENSNLEP00000013638	0.977	Argonaute RISC catalytic component 1
4	61853.ENSNLEP00000013572	0.964	Protein argonaute-4
5	61853.ENSNLEP00000021884	0.944	DEAH (Asp-Glu-Ala-His) box helicase 9
6	61853.ENSNLEP00000004862	0.937	Exportin 5
7	61853.ENSNLEP00000019418	0.937	Hydroxysteroid (17-beta) dehydrogenase 10
8	61853.ENSNLEP00000013937	0.933	Ribonuclease P/MRP 40kDa subunit
9	61853.ENSNLEP00000014436	0.933	Trinucleotide repeat containing 6A
10	61853.ENSNLEP00000015548	0.933	Cleavage and polyadenylation factor I subunit 1
11	61853.ENSNLEP00000007449	0.919	Protein kinase, interferon-inducible double stranded RNA dependent activator
12	61853.ENSNLEP00000013603	0.919	Uncharacterized protein
13	61853.ENSNLEP00000023769	0.919	Belongs to the argonaute family.
14	61853.ENSNLEP00000007338	0.917	LIM domains containing 1
15	61853.ENSNLEP00000014500	0.914	Ribonuclease P protein subunit p20
16	61853.ENSNLEP00000022502	0.909	Ribonuclease P/MRP 38kDa subunit
17	61853.ENSNLEP00000019208	0.908	Ribonuclease P/MRP protein subunit POP5
18	61853.ENSNLEP00000022482	0.903	Ribonuclease P/MRP 25kDa subunit
19	61853.ENSNLEP00000016992	0.889	Drosha, ribonuclease type III
20	61853.ENSNLEP00000008992	0.887	DEAD (Asp-Glu-Ala-Asp) box helicase 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	0.995	RNA binding
GO:0003725	0.943	double-stranded RNA binding
GO:0042802	0.826	identical protein binding
GO:0019899	0.807	enzyme binding
GO:0046983	0.744	protein dimerization activity
GO:0042803	0.726	protein homodimerization activity
GO:0061980	0.625	regulatory RNA binding
GO:0035197	0.535	siRNA binding
GO:0070883	0.526	pre-miRNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0071704	0.989	organic substance metabolic process
GO:0051171	0.988	regulation of nitrogen compound metabolic process
GO:0044238	0.987	primary metabolic process
GO:0044237	0.987	cellular metabolic process
GO:0050794	0.984	regulation of cellular process
GO:0006807	0.983	nitrogen compound metabolic process
GO:0043170	0.982	macromolecule metabolic process
GO:0090304	0.968	nucleic acid metabolic process
GO:0016070	0.944	RNA metabolic process
GO:0010467	0.939	gene expression
GO:0048519	0.938	negative regulation of biological process
GO:0006396	0.931	RNA processing
GO:0060255	0.929	regulation of macromolecule metabolic process
GO:0010468	0.923	regulation of gene expression
GO:0080090	0.922	regulation of primary metabolic process
GO:0031323	0.920	regulation of cellular metabolic process
GO:0048518	0.919	positive regulation of biological process
GO:0034660	0.896	ncRNA metabolic process
GO:0034470	0.888	ncRNA processing
GO:0010605	0.875	negative regulation of macromolecule metabolic process
GO:0010629	0.858	negative regulation of gene expression
GO:0048522	0.806	positive regulation of cellular process
GO:0010608	0.795	post-transcriptional regulation of gene expression
GO:0031047	0.757	RNA-mediated gene silencing
GO:0051246	0.732	regulation of protein metabolic process
GO:0071840	0.727	cellular component organization or biogenesis
GO:0032502	0.664	developmental process
GO:0048523	0.663	negative regulation of cellular process
GO:0016043	0.653	cellular component organization
GO:0048856	0.580	anatomical structure development
GO:0032501	0.551	multicellular organismal process
GO:0051172	0.509	negative regulation of nitrogen compound metabolic process
GO:0031324	0.509	negative regulation of cellular metabolic process
GO:0050896	0.470	response to stimulus
GO:0010556	0.460	regulation of macromolecule biosynthetic process
GO:0031326	0.460	regulation of cellular biosynthetic process
GO:0051252	0.438	regulation of RNA metabolic process
GO:0035196	0.367	miRNA processing
GO:0022607	0.339	cellular component assembly
GO:0051248	0.312	negative regulation of protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005737	1.000	cytoplasm
GO:0005654	0.998	nucleoplasm
GO:0005829	0.991	cytosol
GO:1990904	0.984	ribonucleoprotein complex
GO:1902494	0.962	catalytic complex
GO:1902555	0.948	endoribonuclease complex
GO:0043232	0.941	intracellular non-membrane-bounded organelle
GO:0031332	0.872	RNAi effector complex
GO:0016442	0.850	RISC complex
GO:0016604	0.719	nuclear body
GO:0070578	0.441	RISC-loading complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]