StarFunc result for job id Q15637

User Input

>input (639 residues)
MATGANATPLDFPSKKRKRSRWNQDTMEQKTVIPGMPTVIPPGLTREQERAYIVQLQIED
LTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHNLITEMVALN
PDFKPPADYKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGK
GSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVEQIRNILKQGIETPEDQNDLR
KMQLRELARLNGTLREDDNRILRPWQSSETRSITNTTVCTKCGGAGHIASDCKFQRPGDP
QSAQDKARMDKEYLSLMAELGEAPVPASVGSTSGPATTPLASAPRPAAPANNPPPPSLMS
TTQSRPPWMNSGPSESRPYHGMHGGGPGGPGGGPHSFPHPLPSLTGGHGGHPMQHNPNGP
PPPWMQPPPPPMNQGPHPPGHHGPPPMDQYLGSTPVGSGVYRLHQGKGMMPPPPMGMMPP
PPPPPSGQPPPPPSGPLPPWQQQQQQPPPPPPPSSSMASSTPLPWQQNTTTTTTSAGTGS
IPPWQQQQAAAAASPGAPQMQGNPTMVPLPPGVQPPLPPGAPPPPPPPPPGSAGMMYAPP
PPPPPPMDPSNFVTMMGMGVAGMPPFGMPPAPPPPPPQN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q64213	0.508	0.498	3.491E-86	653	0.920	0.900	Q64213.pdb.gz	SF01_MOUSE Splicing factor 1 OS=Mus musculus OX=10090 GN=Sf1 PE=1 SV=6
2	AFDB:A0A024R566	0.406	0.449	3.451E-70	571	0.743	0.832	A0A024R566.pdb.gz
3	AFDB:A0A0R4IBT0	0.431	0.416	1.039E-69	663	0.768	0.741	A0A0R4IBT0.pdb.gz	A0A0R4IBT0_DANRE Branchpoint-bridging protein OS=Danio rerio OX=7955 GN=wu:fc09f06 PE=1 SV=1
4	AFDB:F1QP64	0.396	0.443	8.381E-69	565	0.746	0.844	F1QP64.pdb.gz
5	AFDB:Q9VEJ1	0.336	0.278	4.227E-45	787	0.423	0.343	Q9VEJ1.pdb.gz	Q9VEJ1_DROME Branchpoint-bridging protein OS=Drosophila melanogaster OX=7227 GN=SF1 PE=1 SV=3
6	AFDB:A3AT67	0.247	0.233	4.746E-25	684	0.319	0.298	A3AT67.pdb.gz	A3AT67_ORYSJ Branchpoint-bridging protein OS=Oryza sativa subsp. japonica OX=39947 GN=OsJ_14553 PE=3 SV=1
7	PDB:6ke6RC	0.101	0.220	4.701E-4	278	0.047	0.108	6ke6RC.pdb.gz	3.4 angstrom cryo-EM structure of yeast 90S small subunit preribosome
8	AFDB:E9QEX9	0.118	0.033	1.540E-3	2607	0.160	0.039	E9QEX9.pdb.gz	E9QEX9_DANRE Ankyrin repeat and KH domain-containing 1 OS=Danio rerio OX=7955 GN=ankhd1 PE=1 SV=1
9	AFDB:Q96M83	0.083	0.047	5.518E-3	1385	0.161	0.074	Q96M83.pdb.gz	CCDC7_HUMAN Coiled-coil domain-containing protein 7 OS=Homo sapiens OX=9606 GN=CCDC7 PE=1 SV=3
10	AFDB:A0A0A0MQZ8	0.104	0.078	6.959E-3	866	0.128	0.095	A0A0A0MQZ8.pdb.gz	A0A0A0MQZ8_HUMAN Ankyrin repeat and KH domain containing 1 OS=Homo sapiens OX=9606 GN=ANKHD1 PE=1 SV=1
11	PDB:7mqaSW	0.121	0.336	2.725E-2	195	0.045	0.149	7mqaSW.pdb.gz	Nucleolar maturation of the human small subunit processome.
12	PDB:7mq8NY	0.102	0.216	5.466E-2	274	0.044	0.102	7mq8NY.pdb.gz	Nucleolar maturation of the human small subunit processome.
13	AFDB:O43719	0.088	0.079	8.427E-2	755	0.135	0.114	O43719.pdb.gz	HTSF1_HUMAN HIV Tat-specific factor 1 OS=Homo sapiens OX=9606 GN=HTATSF1 PE=1 SV=1
14	PDB:3cw2C	0.088	0.188	2.199E-1	266	0.027	0.064	3cw2C.pdb.gz	Crystal structure of the intact archaeal translation initiation factor 2 demonstrates very high conformational flexibility in the alpha- and beta-subunits.
15	PDB:7pubIB	0.068	0.078	5.248E-1	511	0.039	0.049	7pubIB.pdb.gz	Mitoribosomal small subunit maturation involves formation of initiation-like complexes.
16	PDB:6pe4A	0.071	0.061	6.619E-1	758	0.052	0.044	6pe4A.pdb.gz
17	PDB:1fm0E	0.090	0.289	7.014E-1	142	0.038	0.169	1fm0E.pdb.gz
18	PDB:3ezeB	0.078	0.346	9.374E-1	85	0.022	0.165	3ezeB.pdb.gz
19	PDB:1pilA	0.071	0.221	9.933E-1	112	0.016	0.089	1pilA.pdb.gz
20	PDB:7a67A	0.088	0.540	1.253	80	0.020	0.163	7a67A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IBT0	0.0	627	663	0.498	0.480	A0A0R4IBT0_DANRE Branchpoint-bridging protein OS=Danio rerio OX=7955 GN=wu:fc09f06 PE=1 SV=1
2	A0A8I5ZQ56	0.0	889	561	0.684	0.779	A0A8I5ZQ56_RAT Splicing factor 1 OS=Rattus norvegicus OX=10116 GN=Sf1 PE=1 SV=1
3	A0A8I6G7I2	0.0	1170	638	0.928	0.929	A0A8I6G7I2_RAT Splicing factor 1 OS=Rattus norvegicus OX=10116 GN=Sf1 PE=1 SV=1
4	F1LM37	0.0	893	502	0.698	0.888	F1LM37_RAT Splicing factor 1 OS=Rattus norvegicus OX=10116 GN=Sf1 PE=1 SV=3
5	F1LSC3	0.0	1231	649	0.980	0.965	F1LSC3_RAT Splicing factor 1 OS=Rattus norvegicus OX=10116 GN=Sf1 PE=1 SV=3
6	Q15637	0.0	1256	639	1.000	1.000	SF01_HUMAN Splicing factor 1 OS=Homo sapiens OX=9606 GN=SF1 PE=1 SV=4
7	Q64213	0.0	1152	653	0.911	0.891	SF01_MOUSE Splicing factor 1 OS=Mus musculus OX=10090 GN=Sf1 PE=1 SV=6
8	Q6TNQ8	0.0	640	565	0.510	0.577	Q6TNQ8_DANRE Branchpoint-bridging protein OS=Danio rerio OX=7955 GN=SF1 PE=1 SV=1
9	Q9U1J9	6.22e-138	423	773	0.360	0.298	Q9U1J9_DROME Branchpoint-bridging protein OS=Drosophila melanogaster OX=7227 GN=SF1 PE=2 SV=1
10	Q9VEJ1	2.08e-132	409	787	0.376	0.305	Q9VEJ1_DROME Branchpoint-bridging protein OS=Drosophila melanogaster OX=7227 GN=SF1 PE=1 SV=3
11	G5EF97	7.84e-102	327	699	0.264	0.242	G5EF97_CAEEL Branchpoint-bridging protein OS=Caenorhabditis elegans OX=6239 GN=sfa-1 PE=1 SV=1
12	O74555	1.19e-79	265	587	0.211	0.230	BBP_SCHPO Branchpoint-bridging protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bpb1 PE=1 SV=1
13	Q12186	1.69e-71	240	476	0.207	0.277	BBP_YEAST Branchpoint-bridging protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MSL5 PE=1 SV=1
14	Q9LU44	1.12e-60	218	804	0.210	0.167	SF1_ARATH Splicing factor-like protein 1 OS=Arabidopsis thaliana OX=3702 GN=SF1 PE=1 SV=1
15	A3AT67	7.20e-58	209	684	0.194	0.181	A3AT67_ORYSJ Branchpoint-bridging protein OS=Oryza sativa subsp. japonica OX=39947 GN=OsJ_14553 PE=3 SV=1
16	Q91XU1	3.60e-22	100	341	0.103	0.194	QKI_RAT KH domain-containing RNA-binding protein QKI OS=Rattus norvegicus OX=10116 GN=Qki PE=1 SV=2
17	Q96PU8	3.92e-22	100	341	0.103	0.194	QKI_HUMAN KH domain-containing RNA-binding protein QKI OS=Homo sapiens OX=9606 GN=QKI PE=1 SV=1
18	Q9QYS9	3.92e-22	100	341	0.103	0.194	QKI_MOUSE KH domain-containing RNA-binding protein QKI OS=Mus musculus OX=10090 GN=Qki PE=1 SV=1
19	Q6P104	1.65e-21	98.2	319	0.085	0.169	QKIB_DANRE Protein quaking-B OS=Danio rerio OX=7955 GN=qki2 PE=2 SV=1
20	Q32NN2	2.68e-21	97.8	341	0.085	0.158	QKIA_XENLA KH domain-containing RNA-binding protein qki.S OS=Xenopus laevis OX=8355 GN=qki.S PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00013 KH_1	0.00084	30.4	KH domain
2	PF13184 KH_5	5.2e+02	12.2	NusA-like KH domain
3	PF16275 SF1-HH	2.4e-39	145.6	Splicing factor 1 helix-hairpin domain
4	PF00098 zf-CCHC	0.38	22.1	Zinc knuckle
5	PF13917 zf-CCHC_3	1.7e+02	13.5	Zinc knuckle
6	PF14787 zf-CCHC_5	72	14.5	GAG-polyprotein viral zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 89462.XP_006056586.1

Rank	PPI partner	STRING score	Description
1	89462.XP_006064101.1	0.999	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 28 samples with support for all annotated introns
2	89462.XP_006075867.1	0.990	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred complete CDS: deleted 2 bases in 1 codon
3	89462.XP_006044676.1	0.975	U1 small nuclear ribonucleoprotein 70 kDa
4	89462.XP_006069374.1	0.975	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 28 samples with support for all annotated introns
5	89462.XP_006055882.1	0.966	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments, including 24 samples with support for all annotated introns
6	89462.XP_006041470.1	0.963	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 28 samples with support for all annotated introns
7	89462.XP_006055262.1	0.960	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 ESTs, 5 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 29 samples with support for all annotated introns
8	89462.XP_006072830.1	0.953	pre-mRNA-processing factor 39 isoform X1
9	89462.XP_006054289.1	0.951	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 100% coverage of the annotated genomic feature by RNAseq alignments, including 18 samples with support for all annotated introns
10	89462.XP_006075570.1	0.945	tRNA selenocysteine 1-associated protein 1-like
11	89462.XP_006042850.1	0.944	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 10 Proteins, and 98% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
12	89462.XP_006039703.1	0.939	Splicing factor 3B subunit 1-like
13	89462.XP_006078216.1	0.939	Splicing factor 3B subunit 1 isoform X1
14	89462.XP_006071392.1	0.937	Probable ATP-dependent RNA helicase DDX17 isoform X1
15	89462.XP_006071893.1	0.934	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 8 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 14 samples with support for all annotated introns
16	89462.XP_006063891.1	0.928	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 28 samples with support for all annotated introns
17	89462.XP_006068852.1	0.928	Splicing factor U2AF 26 kDa subunit isoform X1
18	89462.XP_006069888.1	0.925	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 24 samples with support for all annotated introns
19	89462.XP_006047874.1	0.923	Splicing factor 3A subunit 2 isoform X1
20	89462.XP_006050417.1	0.922	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 13 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 29 samples with support for all annotated introns

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003723	1.000	RNA binding
GO:0005515	0.972	protein binding
GO:0140110	0.616	transcription regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.986	organic substance metabolic process
GO:0044238	0.986	primary metabolic process
GO:0044237	0.985	cellular metabolic process
GO:0008380	0.977	RNA splicing
GO:0050794	0.975	regulation of cellular process
GO:0006397	0.965	mRNA processing
GO:0048523	0.956	negative regulation of cellular process
GO:0071826	0.906	ribonucleoprotein complex subunit organization
GO:0000377	0.905	RNA splicing, via transesterification reactions with bulged adenosine as nucleophile
GO:0000398	0.904	mRNA splicing, via spliceosome
GO:0042127	0.860	regulation of cell population proliferation
GO:0022613	0.856	ribonucleoprotein complex biogenesis
GO:0008285	0.786	negative regulation of cell population proliferation
GO:0022607	0.446	cellular component assembly
GO:0048660	0.408	regulation of smooth muscle cell proliferation
GO:0022618	0.397	ribonucleoprotein complex assembly
GO:0000245	0.352	spliceosomal complex assembly
GO:0019222	0.343	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0032991	0.912	protein-containing complex
GO:1990904	0.301	ribonucleoprotein complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]