StarFunc result for job id Q15642

User Input

>input (601 residues)
MDWGTELWDQFEVLERHTQWGLDLLDRYVKFVKERTEVEQAYAKQLRSLVKKYLPKRPAK
DDPESKFSQQQSFVQILQEVNDFAGQRELVAENLSVRVCLELTKYSQEMKQERKMHFQEG
RRAQQQLENGFKQLENSKRKFERDCREAEKAAQTAERLDQDINATKADVEKAKQQAHLRS
HMAEESKNEYAAQLQRFNRDQAHFYFSQMPQIFDKLQDMDERRATRLGAGYGLLSEAELE
VVPIIAKCLEGMKVAANAVDPKNDSHVLIELHKSGFARPGDVEFEDFSQPMNRAPSDSSL
GTPSDGRPELRGPGRSRTKRWPFGKKNKPRPPPLSPLGGPVPSALPNGPPSPRSGRDPLA
ILSEISKSVKPRLASFRSLRGSRGTVVTEDFSHLPPEQQRKRLQQQLEERSRELQKEVDQ
REALKKMKDVYEKTPQMGDPASLEPQIAETLSNIERLKLEVQKYEAWLAEAESRVLSNRG
DSLSRHARPPDPPASAPPDSSSNSASQDTKESSEEPPSEESQDTPIYTEFDEDFEEEPTS
PIGHCVAIYHFEGSSEGTISMAEGEDLSLMEEDKGDGWTRVRRKEGGEGYVPTSYLRVTL
N

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8CJ53	0.831	0.828	2.807E-73	603	0.905	0.902	Q8CJ53.pdb.gz	CIP4_MOUSE Cdc42-interacting protein 4 OS=Mus musculus OX=10090 GN=Trip10 PE=1 SV=2
2	AFDB:P97531	0.491	0.539	7.623E-67	547	0.839	0.921	P97531.pdb.gz	CIP4_RAT Cdc42-interacting protein 4 OS=Rattus norvegicus OX=10116 GN=Trip10 PE=1 SV=3
3	AFDB:W4VSQ9	0.502	0.509	9.426E-60	593	0.834	0.845	W4VSQ9.pdb.gz	W4VSQ9_HUMAN Thyroid hormone receptor interactor 10 OS=Homo sapiens OX=9606 GN=TRIP10 PE=1 SV=1
4	AFDB:Q96RU3	0.633	0.618	1.556E-51	617	0.519	0.506	Q96RU3.pdb.gz	FNBP1_HUMAN Formin-binding protein 1 OS=Homo sapiens OX=9606 GN=FNBP1 PE=1 SV=2
5	AFDB:Q5T0N5	0.630	0.627	9.044E-51	605	0.529	0.526	Q5T0N5.pdb.gz	FBP1L_HUMAN Formin-binding protein 1-like OS=Homo sapiens OX=9606 GN=FNBP1L PE=1 SV=3
6	AFDB:B7ZL14	0.507	0.552	1.256E-47	551	0.484	0.528	B7ZL14.pdb.gz	B7ZL14_HUMAN FNBP1 protein OS=Homo sapiens OX=9606 GN=FNBP1 PE=1 SV=1
7	AFDB:M9NF07	0.498	0.480	8.519E-38	623	0.344	0.332	M9NF07.pdb.gz	M9NF07_DROME Cdc42-interacting protein 4, isoform I OS=Drosophila melanogaster OX=7227 GN=Cip4 PE=4 SV=1
8	AFDB:M9PBP3	0.485	0.484	2.611E-36	602	0.346	0.346	M9PBP3.pdb.gz	M9PBP3_DROME Cdc42-interacting protein 4, isoform J OS=Drosophila melanogaster OX=7227 GN=Cip4 PE=4 SV=1
9	AFDB:Q19253	0.444	0.451	1.425E-32	592	0.265	0.269	Q19253.pdb.gz	TOCA1_CAEEL Transducer of Cdc42-dependent actin assembly protein 1 homolog OS=Caenorhabditis elegans OX=6239 GN=toca-1 PE=1 SV=2
10	AFDB:Q9XUS7	0.452	0.446	3.060E-28	610	0.220	0.216	Q9XUS7.pdb.gz	TOCA2_CAEEL Transducer of Cdc42-dependent actin assembly protein 2 homolog OS=Caenorhabditis elegans OX=6239 GN=toca-2 PE=1 SV=2
11	PDB:6ikoA	0.392	0.746	2.209E-8	303	0.080	0.158	6ikoA.pdb.gz
12	PDB:3hajA	0.300	0.576	8.684E-8	286	0.077	0.161	3hajA.pdb.gz	Molecular mechanism of membrane constriction and tubulation mediated by the F-BAR protein Pacsin/Syndapin.
13	PDB:3qwyA	0.101	0.347	1.873E-4	170	0.025	0.088	3qwyA.pdb.gz
14	PDB:1k9aB	0.094	0.128	2.168E-4	441	0.027	0.036	1k9aB.pdb.gz
15	PDB:1k0xA	0.096	0.492	4.494E-3	108	0.020	0.111	1k0xA.pdb.gz
16	PDB:6x5hA	0.095	0.121	5.465E-3	467	0.020	0.026	6x5hA.pdb.gz	Characterizing human alpha-1,6-fucosyltransferase (FUT8) substrate specificity and structural similarities with related fucosyltransferases.
17	PDB:2h8hA	0.085	0.115	1.318E-2	445	0.027	0.036	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
18	PDB:2dybA	0.094	0.187	1.683E-2	298	0.017	0.034	2dybA.pdb.gz
19	PDB:2eyzA	0.098	0.190	3.025E-2	304	0.020	0.039	2eyzA.pdb.gz
20	PDB:1griA	0.096	0.259	3.679E-2	211	0.020	0.057	1griA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B7ZL14	0.0	565	551	0.484	0.528	B7ZL14_HUMAN FNBP1 protein OS=Homo sapiens OX=9606 GN=FNBP1 PE=1 SV=1
2	H0Y7W6	0.0	541	568	0.478	0.505	H0Y7W6_HUMAN Formin binding protein 1 OS=Homo sapiens OX=9606 GN=FNBP1 PE=1 SV=3
3	M0R0F9	0.0	837	437	0.707	0.973	M0R0F9_HUMAN Thyroid hormone receptor interactor 10 OS=Homo sapiens OX=9606 GN=TRIP10 PE=1 SV=1
4	P97531	0.0	883	547	0.800	0.879	CIP4_RAT Cdc42-interacting protein 4 OS=Rattus norvegicus OX=10116 GN=Trip10 PE=1 SV=3
5	Q15642	0.0	1233	601	1.000	1.000	CIP4_HUMAN Cdc42-interacting protein 4 OS=Homo sapiens OX=9606 GN=TRIP10 PE=1 SV=3
6	Q5T0N5	0.0	620	605	0.532	0.529	FBP1L_HUMAN Formin-binding protein 1-like OS=Homo sapiens OX=9606 GN=FNBP1L PE=1 SV=3
7	Q80TY0	0.0	599	616	0.521	0.508	FNBP1_MOUSE Formin-binding protein 1 OS=Mus musculus OX=10090 GN=Fnbp1 PE=1 SV=2
8	Q8CJ53	0.0	1036	603	0.892	0.889	CIP4_MOUSE Cdc42-interacting protein 4 OS=Mus musculus OX=10090 GN=Trip10 PE=1 SV=2
9	Q8R511	0.0	596	616	0.519	0.506	FNBP1_RAT Formin-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Fnbp1 PE=1 SV=2
10	Q96RU3	0.0	609	617	0.522	0.509	FNBP1_HUMAN Formin-binding protein 1 OS=Homo sapiens OX=9606 GN=FNBP1 PE=1 SV=2
11	W4VSQ9	0.0	952	593	0.805	0.816	W4VSQ9_HUMAN Thyroid hormone receptor interactor 10 OS=Homo sapiens OX=9606 GN=TRIP10 PE=1 SV=1
12	A0A075B6Q2	2.87e-137	409	451	0.369	0.492	A0A075B6Q2_HUMAN Formin binding protein 1 like (Fragment) OS=Homo sapiens OX=9606 GN=FNBP1L PE=1 SV=1
13	Q9VZD7	1.47e-107	338	631	0.351	0.334	Q9VZD7_DROME Cdc42-interacting protein 4, isoform A OS=Drosophila melanogaster OX=7227 GN=Cip4 PE=2 SV=2
14	M9ND42	4.26e-107	338	644	0.354	0.331	M9ND42_DROME Cdc42-interacting protein 4, isoform H OS=Drosophila melanogaster OX=7227 GN=Cip4 PE=4 SV=1
15	M9PE52	4.68e-107	337	611	0.346	0.340	M9PE52_DROME Cdc42-interacting protein 4, isoform K OS=Drosophila melanogaster OX=7227 GN=Cip4 PE=4 SV=1
16	A8JNK4	4.99e-107	338	665	0.351	0.317	A8JNK4_DROME Cdc42-interacting protein 4, isoform B OS=Drosophila melanogaster OX=7227 GN=Cip4 PE=4 SV=1
17	M9NE16	6.76e-107	336	612	0.346	0.340	M9NE16_DROME Cdc42-interacting protein 4, isoform C OS=Drosophila melanogaster OX=7227 GN=Cip4 PE=4 SV=1
18	M9ND44	8.07e-107	337	646	0.344	0.320	M9ND44_DROME Cdc42-interacting protein 4, isoform D OS=Drosophila melanogaster OX=7227 GN=Cip4 PE=4 SV=1
19	M9NF07	9.01e-107	336	623	0.353	0.340	M9NF07_DROME Cdc42-interacting protein 4, isoform I OS=Drosophila melanogaster OX=7227 GN=Cip4 PE=4 SV=1
20	M9NF10	1.30e-106	336	624	0.353	0.340	M9NF10_DROME Cdc42-interacting protein 4, isoform E OS=Drosophila melanogaster OX=7227 GN=Cip4 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09968 DUF2202	4.7e+02	12.1	Uncharacterized protein domain (DUF2202)
2	PF04338 DUF481	2.4e+02	13.1	Protein of unknown function, DUF481
3	PF00611 FCH	1.2e-12	59.4	Fes/CIP4, and EFC/F-BAR homology domain
4	PF14389 Lzipper-MIP1	56	15.5	Leucine-zipper of ternary complex factor MIP1
5	PF00018 SH3_1	0.00015	32.6	SH3 domain
6	PF07653 SH3_2	5	18.3	Variant SH3 domain
7	PF08239 SH3_3	1.8	20.4	Bacterial SH3 domain
8	PF06347 SH3_4	3.3e+02	12.5	Bacterial SH3 domain
9	PF14604 SH3_9	0.021	26.0	Variant SH3 domain
10	PF10146 zf-C4H2	7.5e+02	12.0	Zinc finger-containing protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000320117

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000365891	0.997	Wiskott-Aldrich syndrome protein
2	9606.ENSP00000383118	0.997	Cell division control protein 42 homolog
3	9606.ENSP00000223023	0.991	Neural Wiskott-Aldrich syndrome protein
4	9606.ENSP00000238738	0.976	Rho-related GTP-binding protein RhoQ
5	9606.ENSP00000289968	0.952	Rho GTPase-activating protein 17
6	9606.ENSP00000376368	0.939	Wiskott-Aldrich syndrome protein family member 1
7	9606.ENSP00000484855	0.936	Exocyst complex component 5
8	9606.ENSP00000320935	0.934	Solute carrier family 2, facilitated glucose transporter member 4
9	9606.ENSP00000334100	0.922	Exocyst complex component 7
10	9606.ENSP00000355605	0.921	Exocyst complex component 8
11	9606.ENSP00000219255	0.912	Partitioning defective 6 homolog alpha
12	9606.ENSP00000295797	0.912	Protein kinase C iota type
13	9606.ENSP00000367830	0.909	Protein kinase C zeta type
14	9606.ENSP00000253861	0.908	Exocyst complex component 4
15	9606.ENSP00000425587	0.904	Exocyst complex component 3
16	9606.ENSP00000370695	0.903	Exocyst complex component 1
17	9606.ENSP00000260762	0.902	Exocyst complex component 6
18	9606.ENSP00000231368	0.901	Leucyl-cystinyl aminopeptidase
19	9606.ENSP00000230449	0.900	Exocyst complex component 2
20	9606.ENSP00000296641	0.900	Proteinase-activated receptor 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.386	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.998	biological regulation
GO:0009987	0.990	cellular process
GO:0050794	0.989	regulation of cellular process
GO:0050896	0.968	response to stimulus
GO:0007154	0.866	cell communication
GO:0023052	0.862	signaling
GO:0051716	0.769	cellular response to stimulus
GO:0007165	0.658	signal transduction
GO:0051128	0.654	regulation of cellular component organization
GO:0048518	0.415	positive regulation of biological process
GO:0048522	0.395	positive regulation of cellular process
GO:0016043	0.346	cellular component organization
GO:0048519	0.303	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005829	0.987	cytosol
GO:0005634	0.981	nucleus
GO:0005576	0.964	extracellular region
GO:0031974	0.945	membrane-enclosed lumen
GO:0043232	0.942	intracellular non-membrane-bounded organelle
GO:0005886	0.938	plasma membrane
GO:0043233	0.935	organelle lumen
GO:0070013	0.934	intracellular organelle lumen
GO:0031982	0.922	vesicle
GO:0070062	0.914	extracellular exosome
GO:0005654	0.877	nucleoplasm
GO:0005856	0.813	cytoskeleton
GO:0097708	0.404	intracellular vesicle
GO:0015630	0.301	microtubule cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]