StarFunc result for job id Q15643

User Input

>input (1979 residues)
MSSWLGGLGSGLGQSLGQVGGSLASLTGQISNFTKDMLMEGTEEVEAELPDSRTKEIEAI
HAILRSENERLKKLCTDLEEKHEASEIQIKQQSTSYRNQLQQKEVEISHLKARQIALQDQ
LLKLQSAAQSVPSGAGVPATTASSSFAYGISHHPSAFHDDDMDFGDIISSQQEINRLSNE
VSRLESEVGHWRHIAQTSKAQGTDNSDQSEICKLQNIIKELKQNRSQEIDDHQHEMSVLQ
NAHQQKLTEISRRHREELSDYEERIEELENLLQQGGSGVIETDLSKIYEMQKTIQVLQIE
KVESTKKMEQLEDKIKDINKKLSSAENDRDILRREQEQLNVEKRQIMEECENLKLECSKL
QPSAVKQSDTMTEKERILAQSASVEEVFRLQQALSDAENEIMRLSSLNQDNSLAEDNLKL
KMRIEVLEKEKSLLSQEKEELQMSLLKLNNEYEVIKSTATRDISLDSELHDLRLNLEAKE
QELNQSISEKETLIAEIEELDRQNQEATKHMILIKDQLSKQQNEGDSIISKLKQDLNDEK
KRVHQLEDDKMDITKELDVQKEKLIQSEVALNDLHLTKQKLEDKVENLVDQLNKSQESNV
SIQKENLELKEHIRQNEEELSRIRNELMQSLNQDSNSNFKDTLLKEREAEVRNLKQNLSE
LEQLNENLKKVAFDVKMENEKLVLACEDVRHQLEECLAGNNQLSLEKNTIVETLKMEKGE
IEAELCWAKKRLLEEANKYEKTIEELSNARNLNTSALQLEHEHLIKLNQKKDMEIAELKK
NIEQMDTDHKETKDVLSSSLEEQKQLTQLINKKEIFIEKLKERSSKLQEELDKYSQALRK
NEILRQTIEEKDRSLGSMKEENNHLQEELERLREEQSRTAPVADPKTLDSVTELASEVSQ
LNTIKEHLEEEIKHHQKIIEDQNQSKMQLLQSLQEQKKEMDEFRYQHEQMNATHTQLFLE
KDEEIKSLQKTIEQIKTQLHEERQDIQTDNSDIFQETKVQSLNIENGSEKHDLSKAETER
LVKGIKERELEIKLLNEKNISLTKQIDQLSKDEVGKLTQIIQQKDLEIQALHARISSTSH
TQDVVYLQQQLQAYAMEREKVFAVLNEKTRENSHLKTEYHKMMDIVAAKEAALIKLQDEN
KKLSTRFESSGQDMFRETIQNLSRIIREKDIEIDALSQKCQTLLAVLQTSSTGNEAGGVN
SNQFEELLQERDKLKQQVKKMEEWKQQVMTTVQNMQHESAQLQEELHQLQAQVLVDSDNN
SKLQVDYTGLIQSYEQNETKLKNFGQELAQVQHSIGQLCNTKDLLLGKLDIISPQLSSAS
LLTPQSAECLRASKSEVLSESSELLQQELEELRKSLQEKDATIRTLQENNHRLSDSIAAT
SELERKEHEQTDSEIKQLKEKQDVLQKLLKEKDLLIKAKSDQLLSSNENFTNKVNENELL
RQAVTNLKERILILEMDIGKLKGENEKIVETYRGKETEYQALQETNMKFSMMLREKEFEC
HSMKEKALAFEQLLKEKEQGKTGELNQLLNAVKSMQEKTVVFQQERDQVMLALKQKQMEN
TALQNEVQRLRDKEFRSNQELERLRNHLLESEDSYTREALAAEDREAKLRKKVTVLEEKL
VSSSNAMENASHQASVQVESLQEQLNVVSKQRDETALQLSVSQEQVKQYALSLANLQMVL
EHFQQEEKAMYSAELEKQKQLIAEWKKNAENLEGKVISLQECLDEANAALDSASRLTEQL
DVKEEQIEELKRQNELRQEMLDDVQKKLMSLANSSEGKVDKVLMRNLFIGHFHTPKNQRH
EVLRLMGSILGVRREEMEQLFHDDQGGVTRWMTGWLGGGSKSVPNTPLRPNQQSVVNSSF
SELFVKFLETESHPSIPPPKLSVHDMKPLDSPGRRKRDTNAPESFKDTAESRSGRRTDVN
PFLAPRSAAVPLINPAGLGPGGPGHLLLKPISDVLPTFTPLPALPDNSAGVVLKDLLKQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9Q512	0.096	0.096	0.000	1976	0.829	0.830	E9Q512.pdb.gz	E9Q512_MOUSE Thyroid hormone receptor interactor 11 OS=Mus musculus OX=10090 GN=Trip11 PE=1 SV=1
2	AFDB:Q15643	1.000	1.000	0.000	1979	1.000	1.000	Q15643.pdb.gz	TRIPB_HUMAN Thyroid receptor-interacting protein 11 OS=Homo sapiens OX=9606 GN=TRIP11 PE=1 SV=3
3	AFDB:Q9VXU1	0.057	0.087	2.996E-10	1208	0.124	0.204	Q9VXU1.pdb.gz	Q9VXU1_DROME Golgi microtubule-associated protein, isoform B OS=Drosophila melanogaster OX=7227 GN=Gmap PE=1 SV=2
4	AFDB:D0Z5P0	0.092	0.125	1.289E-7	1328	0.126	0.188	D0Z5P0.pdb.gz	D0Z5P0_CAEEL GRIP domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=sql-1 PE=1 SV=1
5	AFDB:A0A2R8QCI3	0.078	0.078	7.127E-5	2023	0.137	0.134	A0A2R8QCI3.pdb.gz	DAPLE_DANRE Protein Daple OS=Danio rerio OX=7955 GN=ccdc88c PE=2 SV=1
6	AFDB:Q14980	0.059	0.057	8.598E-5	2115	0.175	0.164	Q14980.pdb.gz	NUMA1_HUMAN Nuclear mitotic apparatus protein 1 OS=Homo sapiens OX=9606 GN=NUMA1 PE=1 SV=2
7	AFDB:Q6VGS5	0.056	0.056	1.821E-4	2009	0.145	0.142	Q6VGS5.pdb.gz	DAPLE_MOUSE Protein Daple OS=Mus musculus OX=10090 GN=Ccdc88c PE=1 SV=1
8	AFDB:Q5SNZ0	0.058	0.061	2.489E-4	1873	0.150	0.159	Q5SNZ0.pdb.gz	GRDN_MOUSE Girdin OS=Mus musculus OX=10090 GN=Ccdc88a PE=1 SV=2
9	AFDB:A4GSN8	0.047	0.045	3.855E-4	2093	0.168	0.159	A4GSN8.pdb.gz	NUA_ARATH Nuclear-pore anchor OS=Arabidopsis thaliana OX=3702 GN=NUA PE=1 SV=1
10	AFDB:Q8IR55	0.065	0.055	3.855E-4	2567	0.174	0.134	Q8IR55.pdb.gz	Q8IR55_DROME Mushroom body defect, isoform H OS=Drosophila melanogaster OX=7227 GN=mud PE=1 SV=3
11	PDB:7r5jV0	0.025	0.127	3.651	273	0.020	0.147	7r5jV0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
12	PDB:7d5sRN	0.021	0.061	4.990	607	0.010	0.033	7d5sRN.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
13	PDB:5wlcST	0.021	0.061	7.262	599	0.010	0.033	5wlcST.pdb.gz	The complete structure of the small-subunit processome.
14	PDB:6gejS	0.020	0.144	7.262	208	0.008	0.077	6gejS.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B2RY51	0.0	3126	1976	0.819	0.820	B2RY51_MOUSE Thyroid hormone receptor interactor 11 OS=Mus musculus OX=10090 GN=Trip11 PE=2 SV=1
2	D4ABD7	0.0	3150	1973	0.813	0.816	D4ABD7_RAT Thyroid hormone receptor interactor 11 OS=Rattus norvegicus OX=10116 GN=Trip11 PE=1 SV=4
3	E9Q512	0.0	3133	1976	0.819	0.820	E9Q512_MOUSE Thyroid hormone receptor interactor 11 OS=Mus musculus OX=10090 GN=Trip11 PE=1 SV=1
4	H0YJ97	0.0	3360	1695	0.856	0.999	H0YJ97_HUMAN Thyroid hormone receptor interactor 11 (Fragment) OS=Homo sapiens OX=9606 GN=TRIP11 PE=1 SV=1
5	H3BJG4	0.0	2710	1691	0.713	0.834	H3BJG4_MOUSE Thyroid hormone receptor interactor 11 (Fragment) OS=Mus musculus OX=10090 GN=Trip11 PE=1 SV=1
6	Q15643	0.0	3960	1979	1.000	1.000	TRIPB_HUMAN Thyroid receptor-interacting protein 11 OS=Homo sapiens OX=9606 GN=TRIP11 PE=1 SV=3
7	Q3UFU7	0.0	827	595	0.221	0.734	Q3UFU7_MOUSE Thyroid hormone receptor interactor 11 (Fragment) OS=Mus musculus OX=10090 GN=Trip11 PE=2 SV=1
8	Q3UTR9	0.0	584	450	0.167	0.733	Q3UTR9_MOUSE Uncharacterized protein (Fragment) OS=Mus musculus OX=10090 GN=Trip11 PE=2 SV=1
9	Q811I5	0.0	830	461	0.210	0.900	Q811I5_MOUSE Trip11 protein (Fragment) OS=Mus musculus OX=10090 GN=Trip11 PE=2 SV=1
10	Q8BVJ9	0.0	739	527	0.195	0.731	Q8BVJ9_MOUSE Thyroid hormone receptor interactor 11 (Fragment) OS=Mus musculus OX=10090 GN=Trip11 PE=1 SV=1
11	Q9CRV3	1.64e-114	367	291	0.105	0.711	Q9CRV3_MOUSE Thyroid hormone receptor interactor 11 (Fragment) OS=Mus musculus OX=10090 GN=Trip11 PE=2 SV=1
12	H3BJH8	2.59e-114	366	291	0.105	0.711	H3BJH8_MOUSE Thyroid hormone receptor interactor 11 (Fragment) OS=Mus musculus OX=10090 GN=Trip11 PE=1 SV=1
13	H3BJU5	8.20e-61	207	139	0.054	0.763	H3BJU5_MOUSE Thyroid hormone receptor interactor 11 (Fragment) OS=Mus musculus OX=10090 GN=Trip11 PE=1 SV=1
14	Q9VXU1	1.82e-20	101	1208	0.060	0.098	Q9VXU1_DROME Golgi microtubule-associated protein, isoform B OS=Drosophila melanogaster OX=7227 GN=Gmap PE=1 SV=2
15	Q9VXU2	3.62e-20	100	1398	0.060	0.084	Q9VXU2_DROME Golgi microtubule-associated protein, isoform A OS=Drosophila melanogaster OX=7227 GN=Gmap PE=1 SV=2
16	A0A4D6K5M0	4.82e-20	100	1401	0.060	0.084	A0A4D6K5M0_DROME Golgi microtubule-associated protein, isoform D OS=Drosophila melanogaster OX=7227 GN=Gmap PE=1 SV=1
17	D0Z5P0	1.14e-11	72.8	1328	0.049	0.073	D0Z5P0_CAEEL GRIP domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=sql-1 PE=1 SV=1
18	Q8BMX5	1.55e-09	58.5	81	0.019	0.469	Q8BMX5_MOUSE Uncharacterized protein OS=Mus musculus OX=10090 GN=Trip11 PE=2 SV=1
19	Q84WU4	0.005	44.3	712	0.044	0.124	GOGC3_ARATH Golgin candidate 3 OS=Arabidopsis thaliana OX=3702 GN=GC3 PE=1 SV=1
20	Q10411	0.015	43.1	1957	0.025	0.026	SPO15_SCHPO Sporulation-specific protein 15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=spo15 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07485 DUF1529	50	15.2	Domain of Unknown Function (DUF1259)
2	PF14362 DUF4407	6	17.7	Domain of unknown function (DUF4407)
3	PF10375 GRAB	0.032	25.3	GRAB domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000267622

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000464443	0.998	Intraflagellar transport protein 20 homolog
2	9606.ENSP00000262646	0.968	Ras-related protein Rab-2A
3	9606.ENSP00000440005	0.965	ADP-ribosylation factor 1
4	9606.ENSP00000351407	0.943	Aryl hydrocarbon receptor nuclear translocator
5	9606.ENSP00000358548	0.917	GTPase NRas
6	9606.ENSP00000407586	0.911	GTPase HRas
7	9606.ENSP00000256078	0.909	GTPase KRas
8	9606.ENSP00000377275	0.859	Golgin subfamily B member 1
9	9606.ENSP00000437073	0.837	Unconventional myosin-XVIIIa
10	9606.ENSP00000163416	0.823	Golgin subfamily A member 5
11	9606.ENSP00000416097	0.820	Golgin subfamily A member 2
12	9606.ENSP00000349305	0.814	Golgin subfamily A member 4
13	9606.ENSP00000307939	0.804	GRIP and coiled-coil domain-containing protein 2
14	9606.ENSP00000379658	0.803	Transcription factor ETV6
15	9606.ENSP00000362656	0.785	Golgin subfamily A member 1
16	9606.ENSP00000263245	0.778	ADP-ribosylation factor GTPase-activating protein 3
17	9606.ENSP00000444850	0.761	General vesicular transport factor p115
18	9606.ENSP00000204726	0.734	Golgin subfamily A member 3
19	9606.ENSP00000286298	0.727	Sulfate transporter
20	9606.ENSP00000318821	0.720	GRIP and coiled-coil domain-containing protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003713	0.907	transcription coactivator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0008152	0.921	metabolic process
GO:0016043	0.894	cellular component organization
GO:0006996	0.882	organelle organization
GO:0010256	0.854	endomembrane system organization
GO:0007030	0.838	Golgi organization
GO:0071704	0.819	organic substance metabolic process
GO:0032502	0.811	developmental process
GO:0048856	0.804	anatomical structure development
GO:0044237	0.784	cellular metabolic process
GO:0032501	0.780	multicellular organismal process
GO:0051179	0.750	localization
GO:0044238	0.747	primary metabolic process
GO:0051234	0.727	establishment of localization
GO:0061448	0.721	connective tissue development
GO:0006807	0.717	nitrogen compound metabolic process
GO:0007275	0.709	multicellular organism development
GO:0043170	0.707	macromolecule metabolic process
GO:0016192	0.696	vesicle-mediated transport
GO:0051641	0.651	cellular localization
GO:0048731	0.624	system development
GO:0051216	0.611	cartilage development
GO:0009058	0.576	biosynthetic process
GO:0009059	0.572	macromolecule biosynthetic process
GO:0044249	0.570	cellular biosynthetic process
GO:0051649	0.510	establishment of localization in cell
GO:0065007	0.497	biological regulation
GO:0050794	0.460	regulation of cellular process
GO:1901360	0.426	organic cyclic compound metabolic process
GO:0006725	0.425	cellular aromatic compound metabolic process
GO:0046483	0.394	heterocycle metabolic process
GO:0034641	0.375	cellular nitrogen compound metabolic process
GO:1901564	0.335	organonitrogen compound metabolic process
GO:0048705	0.332	skeletal system morphogenesis
GO:0030154	0.318	cell differentiation
GO:0044260	0.313	cellular macromolecule metabolic process
GO:0007507	0.311	heart development
GO:0019538	0.306	protein metabolic process
GO:0060348	0.304	bone development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005794	1.000	Golgi apparatus
GO:0005654	0.999	nucleoplasm
GO:0098588	0.997	bounding membrane of organelle
GO:0031982	0.987	vesicle
GO:0031410	0.931	cytoplasmic vesicle
GO:0005829	0.928	cytosol
GO:0000139	0.621	Golgi membrane
GO:0016604	0.604	nuclear body
GO:0030659	0.532	cytoplasmic vesicle membrane
GO:0016607	0.442	nuclear speck

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]