StarFunc result for job id Q15645

User Input

>input (432 residues)
MDEAVGDLKQALPCVAESPTVHVEVHQRGSSTAKKEDINLSVRKLLNRHNIVFGDYTWTE
FDEPFLTRNVQSVSIIDTELKVKDSQPIDLSACTVALHIFQLNEDGPSSENLEEETENII
AANHWVLPAAEFHGLWDSLVYDVEVKSHLLDYVMTTLLFSDKNVNSNLITWNRVVLLHGP
PGTGKTSLCKALAQKLTIRLSSRYRYGQLIEINSHSLFSKWFSESGKLVTKMFQKIQDLI
DDKDALVFVLIDEVESLTAARNACRAGTEPSDAIRVVNAVLTQIDQIKRHSNVVILTTSN
ITEKIDVAFVDRADIKQYIGPPSAAAIFKIYLSCLEELMKCQIIYPRQQLLTLRELEMIG
FIENNVSKLSLLLNDISRKSEGLSGRVLRKLPFLAHALYVQAPTVTIEGFLQALSLAVDK
QFEERKKLAAYI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15645	1.000	1.000	1.425E-85	432	1.000	1.000	Q15645.pdb.gz	PCH2_HUMAN Pachytene checkpoint protein 2 homolog OS=Homo sapiens OX=9606 GN=TRIP13 PE=1 SV=2
2	PDB:5vqaA	0.834	0.977	1.907E-63	368	0.845	0.992	5vqaA.pdb.gz	The AAA+ ATPase TRIP13 remodels HORMA domains through N-terminal engagement and unfolding.
3	PDB:6f0xB	0.876	0.948	2.212E-59	398	0.914	0.992	6f0xB.pdb.gz	Mechanism for remodelling of the cell cycle checkpoint protein MAD2 by the ATPase TRIP13.
4	PDB:6lk0A	0.751	0.960	8.064E-57	336	0.769	0.988	6lk0A.pdb.gz
5	AFDB:Q7XK25	0.916	0.835	1.801E-50	475	0.472	0.429	Q7XK25.pdb.gz	PCH2_ORYSJ Pachytene checkpoint protein 2 homolog OS=Oryza sativa subsp. japonica OX=39947 GN=CRC1 PE=1 SV=4
6	AFDB:Q8H1F9	0.909	0.843	5.000E-50	467	0.475	0.439	Q8H1F9.pdb.gz	PCH2_ARATH Pachytene checkpoint protein 2 homolog OS=Arabidopsis thaliana OX=3702 GN=PCH2 PE=2 SV=1
7	AFDB:Q8SX76	0.845	0.866	3.329E-43	421	0.417	0.428	Q8SX76.pdb.gz	Q8SX76_DROME LD24646p OS=Drosophila melanogaster OX=7227 GN=pch2 PE=1 SV=1
8	AFDB:Q09535	0.829	0.844	4.897E-41	424	0.343	0.349	Q09535.pdb.gz	PCH2_CAEEL Putative pachytene checkpoint protein 2 OS=Caenorhabditis elegans OX=6239 GN=pch-2 PE=1 SV=1
9	PDB:4xguB	0.756	0.849	8.675E-34	382	0.324	0.366	4xguB.pdb.gz	TRIP13 is a protein-remodeling AAA+ ATPase that catalyzes MAD2 conformation switching.
10	AFDB:P38126	0.718	0.558	4.693E-28	564	0.317	0.243	P38126.pdb.gz	PCH2_YEAST Pachytene checkpoint protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PCH2 PE=1 SV=2
11	PDB:7ln6F	0.457	0.290	2.966E-14	714	0.181	0.109	7ln6F.pdb.gz	Mechanistic insight into substrate processing and allosteric inhibition of human p97.
12	AFDB:Q505J9	0.480	0.563	5.456E-14	361	0.144	0.172	Q505J9.pdb.gz	ATAD1_RAT Outer mitochondrial transmembrane helix translocase OS=Rattus norvegicus OX=10116 GN=Atad1 PE=1 SV=1
13	AFDB:Q9VEX6	0.502	0.369	7.245E-14	604	0.130	0.093	Q9VEX6.pdb.gz	ATD3A_DROME ATPase family AAA domain-containing protein 3A homolog OS=Drosophila melanogaster OX=7227 GN=bor PE=1 SV=2
14	AFDB:Q9SCN8	0.460	0.259	7.668E-14	815	0.171	0.091	Q9SCN8.pdb.gz	CD48D_ARATH Cell division control protein 48 homolog D OS=Arabidopsis thaliana OX=3702 GN=CDC48D PE=1 SV=1
15	AFDB:Q9BW62	0.457	0.407	8.589E-14	490	0.188	0.165	Q9BW62.pdb.gz	KATL1_HUMAN Katanin p60 ATPase-containing subunit A-like 1 OS=Homo sapiens OX=9606 GN=KATNAL1 PE=1 SV=1
16	PDB:5l4gL	0.434	0.474	1.572E-12	389	0.162	0.180	5l4gL.pdb.gz	Structure of the human 26S proteasome at a resolution of 3.9 angstrom.
17	PDB:5ifwB	0.458	0.298	1.972E-12	702	0.174	0.107	5ifwB.pdb.gz	Quantitative interaction mapping reveals an extended UBX domain in ASPL that disrupts functional p97 hexamers.
18	PDB:7vcsA	0.395	0.242	2.619E-12	766	0.160	0.090	7vcsA.pdb.gz	Cryo-EM structures of human p97 double hexamer capture potentiated ATPase-competent state.
19	PDB:7pxcD	0.429	0.409	3.105E-12	457	0.153	0.144	7pxcD.pdb.gz	Structural basis of prokaryotic ubiquitin-like protein engagement and translocation by the mycobacterial Mpa-proteasome complex.
20	PDB:5mp9I	0.443	0.491	3.681E-12	385	0.137	0.153	5mp9I.pdb.gz	Structural insights into the functional cycle of the ATPase module of the 26S proteasome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q15645	0.0	889	432	1.000	1.000	PCH2_HUMAN Pachytene checkpoint protein 2 homolog OS=Homo sapiens OX=9606 GN=TRIP13 PE=1 SV=2
2	Q3UA06	0.0	841	432	0.933	0.933	PCH2_MOUSE Pachytene checkpoint protein 2 homolog OS=Mus musculus OX=10090 GN=Trip13 PE=1 SV=1
3	Q7XK25	7.34e-134	395	475	0.479	0.436	PCH2_ORYSJ Pachytene checkpoint protein 2 homolog OS=Oryza sativa subsp. japonica OX=39947 GN=CRC1 PE=1 SV=4
4	Q8H1F9	7.29e-128	379	467	0.475	0.439	PCH2_ARATH Pachytene checkpoint protein 2 homolog OS=Arabidopsis thaliana OX=3702 GN=PCH2 PE=2 SV=1
5	Q8SX76	1.22e-102	313	421	0.428	0.439	Q8SX76_DROME LD24646p OS=Drosophila melanogaster OX=7227 GN=pch2 PE=1 SV=1
6	Q09535	1.05e-82	262	424	0.333	0.340	PCH2_CAEEL Putative pachytene checkpoint protein 2 OS=Caenorhabditis elegans OX=6239 GN=pch-2 PE=1 SV=1
7	P38126	2.89e-54	191	564	0.275	0.211	PCH2_YEAST Pachytene checkpoint protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PCH2 PE=1 SV=2
8	Q54PT2	1.99e-15	80.1	444	0.134	0.131	VPS4_DICDI Vacuolar protein sorting-associated protein 4 OS=Dictyostelium discoideum OX=44689 GN=vps4 PE=3 SV=1
9	Q9P3A7	2.37e-15	80.9	815	0.139	0.074	CDC48_SCHPO Cell division cycle protein 48 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cdc48 PE=1 SV=2
10	P25694	8.41e-15	79.0	835	0.127	0.066	CDC48_YEAST Cell division control protein 48 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CDC48 PE=1 SV=3
11	Q9LET7	1.08e-14	79.0	1022	0.144	0.061	CI111_ARATH Calmodulin-interacting protein 111 OS=Arabidopsis thaliana OX=3702 GN=CIP111 PE=1 SV=1
12	Q6FNS8	1.43e-14	78.2	830	0.125	0.065	Q6FNS8_CANGA Candida glabrata strain CBS138 chromosome J complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CDC48 PE=4 SV=1
13	P46468	2.34e-14	77.8	1229	0.137	0.048	CDAT_PLAF7 Putative cell division cycle ATPase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF07_0047 PE=3 SV=2
14	Q57V58	6.05e-14	75.5	444	0.125	0.122	Q57V58_TRYB2 Katanin, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.3K10.340 PE=3 SV=1
15	P54812	8.20e-14	75.9	810	0.174	0.093	TERA2_CAEEL Transitional endoplasmic reticulum ATPase homolog 2 OS=Caenorhabditis elegans OX=6239 GN=cdc-48.2 PE=1 SV=2
16	Q9ZNT0	9.26e-14	75.1	435	0.118	0.117	VPS4_ARATH Protein SUPPRESSOR OF K(+) TRANSPORT GROWTH DEFECT 1 OS=Arabidopsis thaliana OX=3702 GN=SKD1 PE=1 SV=1
17	Q59WG3	1.30e-13	75.5	826	0.148	0.077	Q59WG3_CANAL AAA family ATPase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CDC48 PE=4 SV=1
18	P32794	1.44e-13	75.1	780	0.125	0.069	AFG2_YEAST ATPase family gene 2 protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AFG2 PE=1 SV=1
19	P46467	2.69e-13	73.6	444	0.125	0.122	VPS4B_MOUSE Vacuolar protein sorting-associated protein 4B OS=Mus musculus OX=10090 GN=Vps4b PE=1 SV=2
20	O75351	3.65e-13	73.2	444	0.125	0.122	VPS4B_HUMAN Vacuolar protein sorting-associated protein 4B OS=Homo sapiens OX=9606 GN=VPS4B PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00004 AAA	2.7e-27	107.2	ATPase family associated with various cellular activities (AAA)
2	PF13086 AAA_11	12	17.1	AAA domain
3	PF13173 AAA_14	0.71	21.3	AAA domain
4	PF13191 AAA_16	0.02	26.8	AAA ATPase domain
5	PF13207 AAA_17	67	15.3	AAA domain
6	PF13238 AAA_18	0.012	27.6	AAA domain
7	PF13245 AAA_19	1.4e+02	14.1	AAA domain
8	PF07724 AAA_2	1.6e+02	13.8	AAA domain (Cdc48 subfamily)
9	PF13401 AAA_22	0.00082	31.1	AAA domain
10	PF13479 AAA_24	11	17.3	AAA domain
11	PF13481 AAA_25	2	19.5	AAA domain
12	PF13521 AAA_28	12	17.6	AAA domain
13	PF13555 AAA_29	6.5e+02	11.5	P-loop containing region of AAA domain
14	PF07726 AAA_3	4.1e+02	12.2	ATPase family associated with various cellular activities (AAA)
15	PF13604 AAA_30	13	16.9	AAA domain
16	PF13671 AAA_33	0.13	23.9	AAA domain
17	PF07728 AAA_5	5.8	18.4	AAA domain (dynein-related subfamily)
18	PF12775 AAA_7	13	16.7	P-loop containing dynein motor region
19	PF00005 ABC_tran	28	16.7	ABC transporter
20	PF06745 ATPase	49	14.7	KaiC

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000166345

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000296509	0.998	Mitotic spindle assembly checkpoint protein MAD2A
2	9606.ENSP00000361540	0.998	Cell division cycle protein 20 homolog
3	9606.ENSP00000410818	0.990	MAD2L1-binding protein
4	9606.ENSP00000378699	0.971	Cyclin-dependent kinase 1
5	9606.ENSP00000287598	0.953	Mitotic checkpoint serine/threonine-protein kinase BUB1 beta
6	9606.ENSP00000274026	0.932	Cyclin-A2
7	9606.ENSP00000313950	0.920	Aurora kinase B
8	9606.ENSP00000260731	0.908	Kinesin-like protein KIF11
9	9606.ENSP00000360310	0.906	Meiotic recombination protein SPO11
10	9606.ENSP00000378356	0.899	Kinesin-like protein KIF20A
11	9606.ENSP00000372088	0.897	DNA repair protein RAD51 homolog 1
12	9606.ENSP00000216911	0.895	Aurora kinase A
13	9606.ENSP00000256442	0.892	G2/mitotic-specific cyclin-B1
14	9606.ENSP00000288207	0.892	G2/mitotic-specific cyclin-B2
15	9606.ENSP00000251496	0.891	Condensin complex subunit 3
16	9606.ENSP00000253462	0.891	DNA replication complex GINS protein PSF2
17	9606.ENSP00000348838	0.885	Ubiquitin-conjugating enzyme E2 C
18	9606.ENSP00000298048	0.879	Maternal embryonic leucine zipper kinase
19	9606.ENSP00000362146	0.879	Borealin
20	9606.ENSP00000300403	0.878	Targeting protein for Xklp2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0042802	0.963	identical protein binding
GO:0003712	0.957	transcription coregulator activity
GO:0097159	0.439	organic cyclic compound binding
GO:1901363	0.438	heterocyclic compound binding
GO:0003824	0.415	catalytic activity
GO:0003676	0.376	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0071704	0.991	organic substance metabolic process
GO:0044238	0.988	primary metabolic process
GO:0006807	0.984	nitrogen compound metabolic process
GO:0044237	0.983	cellular metabolic process
GO:0043170	0.975	macromolecule metabolic process
GO:0007049	0.946	cell cycle
GO:0022402	0.939	cell cycle process
GO:0046483	0.939	heterocycle metabolic process
GO:0006725	0.909	cellular aromatic compound metabolic process
GO:0034641	0.906	cellular nitrogen compound metabolic process
GO:1901360	0.905	organic cyclic compound metabolic process
GO:0006139	0.904	nucleobase-containing compound metabolic process
GO:0090304	0.889	nucleic acid metabolic process
GO:0050896	0.862	response to stimulus
GO:0050789	0.861	regulation of biological process
GO:0050794	0.851	regulation of cellular process
GO:0051716	0.795	cellular response to stimulus
GO:0071840	0.661	cellular component organization or biogenesis
GO:0016043	0.649	cellular component organization
GO:0044260	0.494	cellular macromolecule metabolic process
GO:0051726	0.487	regulation of cell cycle
GO:0000278	0.482	mitotic cell cycle
GO:0010564	0.473	regulation of cell cycle process
GO:1903047	0.461	mitotic cell cycle process
GO:0006996	0.440	organelle organization
GO:0033043	0.376	regulation of organelle organization
GO:0048519	0.361	negative regulation of biological process
GO:1901987	0.355	regulation of cell cycle phase transition
GO:0006259	0.355	DNA metabolic process
GO:0048523	0.353	negative regulation of cellular process
GO:0007346	0.319	regulation of mitotic cell cycle
GO:1901990	0.309	regulation of mitotic cell cycle phase transition

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.975	intracellular organelle lumen
GO:0005654	0.969	nucleoplasm
GO:0043232	0.945	intracellular non-membrane-bounded organelle
GO:0005737	0.704	cytoplasm
GO:0032991	0.369	protein-containing complex
GO:0005829	0.341	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]