StarFunc result for job id Q15646

User Input

>input (514 residues)
MALMQELYSTPASRLDSFVAQWLQPHREWKEEVLDAVRTVEEFLRQEHFQGKRGLDQDVR
VLKVVKVGSFGNGTVLRSTREVELVAFLSCFHSFQEAAKHHKDVLRLIWKTMWQSQDLLD
LGLEDLRMEQRVPDALVFTIQTRGTAEPITVTIVPAYRALGPSLPNSQPPPEVYVSLIKA
CGGPGNFCPSFSELQRNFVKHRPTKLKSLLRLVKHWYQQYVKARSPRANLPPLYALELLT
IYAWEMGTEEDENFMLDEGFTTVMDLLLEYEVICIYWTKYYTLHNAIIEDCVRKQLKKER
PIILDPADPTLNVAEGYRWDIVAQRASQCLKQDCCYDNRENPISSWNVKRARDIHLTVEQ
RGYPDFNLIVNPYEPIRKVKEKIRRTRGYSGLQRLSFQVPGSERQLLSSRCSLAKYGIFS
HTHIYLLETIPSEIQVFVKNPDGGSYAYAINPNSFILGLKQQIEDQQGLPKKQQQLEFQG
QVLQDWLGLGIYGIQDSDTLILSKKKGEALFPAS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15646	1.000	1.000	0.000	514	1.000	1.000	Q15646.pdb.gz	OASL_HUMAN 2'-5'-oligoadenylate synthase-like protein OS=Homo sapiens OX=9606 GN=OASL PE=1 SV=2
2	AFDB:Q8VI94	0.818	0.823	1.100E-84	511	0.702	0.706	Q8VI94.pdb.gz	OASL1_MOUSE 2'-5'-oligoadenylate synthase-like protein 1 OS=Mus musculus OX=10090 GN=Oasl1 PE=2 SV=1
3	AFDB:Q9Z2F2	0.775	0.784	4.289E-62	508	0.482	0.488	Q9Z2F2.pdb.gz	OASL2_MOUSE 2'-5'-oligoadenylate synthase-like protein 2 OS=Mus musculus OX=10090 GN=Oasl2 PE=1 SV=2
4	AFDB:Q5MYT9	0.812	0.817	7.115E-61	511	0.455	0.458	Q5MYT9.pdb.gz	OASL2_RAT 2'-5'-oligoadenylate synthase-like protein 2 OS=Rattus norvegicus OX=10116 GN=Oasl2 PE=2 SV=1
5	AFDB:Q9Y6K5	0.613	0.297	1.069E-35	1087	0.272	0.129	Q9Y6K5.pdb.gz	OAS3_HUMAN 2'-5'-oligoadenylate synthase 3 OS=Homo sapiens OX=9606 GN=OAS3 PE=1 SV=3
6	AFDB:Q8VI93	0.615	0.284	6.100E-35	1138	0.274	0.124	Q8VI93.pdb.gz	OAS3_MOUSE 2'-5'-oligoadenylate synthase 3 OS=Mus musculus OX=10090 GN=Oas3 PE=1 SV=1
7	AFDB:P00973	0.614	0.783	4.609E-34	400	0.270	0.347	P00973.pdb.gz	OAS1_HUMAN 2'-5'-oligoadenylate synthase 1 OS=Homo sapiens OX=9606 GN=OAS1 PE=1 SV=4
8	AFDB:Q05961	0.621	0.882	1.678E-33	358	0.270	0.388	Q05961.pdb.gz	OAS1A_RAT 2'-5'-oligoadenylate synthase 1A OS=Rattus norvegicus OX=10116 GN=Oas1a PE=2 SV=1
9	PDB:4rwnA	0.622	0.906	2.116E-33	349	0.272	0.401	4rwnA.pdb.gz	The Activation Mechanism of 2'-5'-Oligoadenylate Synthetase Gives New Insights Into OAS/cGAS Triggers of Innate Immunity.
10	AFDB:Q3ZM02	0.603	0.672	2.350E-33	459	0.270	0.303	Q3ZM02.pdb.gz	Q3ZM02_HUMAN 2'-5' oligoadenylate synthase OS=Homo sapiens OX=9606 GN=OAS1 PE=2 SV=1
11	AFDB:G3SFB1	0.614	0.757	2.630E-33	414	0.272	0.338	G3SFB1.pdb.gz	G3SFB1_GORGO 2'-5' oligoadenylate synthase OS=Gorilla gorilla gorilla OX=9595 GN=OAS1 PE=3 SV=2
12	PDB:7rbsB	0.194	0.507	5.256E-13	157	0.074	0.242	7rbsB.pdb.gz	Dual domain recognition determines SARS-CoV-2 PLpro selectivity for human ISG15 and K48-linked di-ubiquitin.
13	PDB:6yvaC	0.192	0.507	2.680E-12	155	0.068	0.226	6yvaC.pdb.gz
14	PDB:6mdhA	0.255	0.770	3.971E-12	149	0.068	0.235	6mdhA.pdb.gz
15	PDB:3ai5A	0.144	0.244	1.295E-7	299	0.060	0.104	3ai5A.pdb.gz
16	PDB:4atbA	0.334	0.483	1.715E-7	334	0.091	0.141	4atbA.pdb.gz	NF45 Dimerizes with NF90, Zfr and Spnr Via a Conserved Domain that Has a Nucleotidyltransferase Fold.
17	PDB:4e7xD	0.380	0.575	1.225E-6	320	0.089	0.144	4e7xD.pdb.gz
18	PDB:4pyuA	0.143	0.908	1.533E-6	76	0.039	0.263	4pyuA.pdb.gz	The conserved ubiquitin-like protein Hub1 plays a critical role in splicing in human cells.
19	PDB:5wyjCB	0.371	0.193	2.689E-6	1098	0.068	0.032	5wyjCB.pdb.gz	Molecular architecture of the 90S small subunit pre-ribosome.
20	PDB:3dbhI	0.148	0.822	5.277E-6	86	0.037	0.221	3dbhI.pdb.gz	Structural dissection of a gating mechanism preventing misactivation of ubiquitin by NEDD8's E1.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q15646	0.0	1066	514	1.000	1.000	OASL_HUMAN 2'-5'-oligoadenylate synthase-like protein OS=Homo sapiens OX=9606 GN=OASL PE=1 SV=2
2	Q8VI94	0.0	739	511	0.704	0.708	OASL1_MOUSE 2'-5'-oligoadenylate synthase-like protein 1 OS=Mus musculus OX=10090 GN=Oasl1 PE=2 SV=1
3	Q9Z2F2	2.69e-157	459	508	0.484	0.490	OASL2_MOUSE 2'-5'-oligoadenylate synthase-like protein 2 OS=Mus musculus OX=10090 GN=Oasl2 PE=1 SV=2
4	Q5MYT9	5.93e-151	443	511	0.455	0.458	OASL2_RAT 2'-5'-oligoadenylate synthase-like protein 2 OS=Rattus norvegicus OX=10116 GN=Oasl2 PE=2 SV=1
5	Q91YM7	2.83e-84	271	515	0.272	0.272	Q91YM7_MOUSE 2'-5' oligoadenylate synthase (Fragment) OS=Mus musculus OX=10090 GN=Oas3 PE=2 SV=1
6	Q8VI93	4.80e-80	273	1138	0.270	0.122	OAS3_MOUSE 2'-5'-oligoadenylate synthase 3 OS=Mus musculus OX=10090 GN=Oas3 PE=1 SV=1
7	Q9Y6K5	2.63e-79	270	1087	0.276	0.131	OAS3_HUMAN 2'-5'-oligoadenylate synthase 3 OS=Homo sapiens OX=9606 GN=OAS3 PE=1 SV=3
8	Q29599	1.37e-77	249	349	0.272	0.401	OAS1_PIG 2'-5'-oligoadenylate synthase 1 OS=Sus scrofa OX=9823 GN=OAS1 PE=1 SV=3
9	G3SFB1	2.36e-75	245	414	0.276	0.343	G3SFB1_GORGO 2'-5' oligoadenylate synthase OS=Gorilla gorilla gorilla OX=9595 GN=OAS1 PE=3 SV=2
10	H0YIB8	1.22e-74	243	384	0.274	0.367	H0YIB8_HUMAN 2'-5' oligoadenylate synthase OS=Homo sapiens OX=9606 GN=OAS1 PE=1 SV=2
11	S4R3A5	2.28e-74	242	403	0.274	0.350	S4R3A5_HUMAN 2'-5' oligoadenylate synthase OS=Homo sapiens OX=9606 GN=OAS1 PE=1 SV=2
12	P00973	4.14e-74	241	400	0.274	0.352	OAS1_HUMAN 2'-5'-oligoadenylate synthase 1 OS=Homo sapiens OX=9606 GN=OAS1 PE=1 SV=4
13	Q3ZM02	1.62e-73	242	459	0.276	0.309	Q3ZM02_HUMAN 2'-5' oligoadenylate synthase OS=Homo sapiens OX=9606 GN=OAS1 PE=2 SV=1
14	Q05961	2.87e-72	235	358	0.274	0.394	OAS1A_RAT 2'-5'-oligoadenylate synthase 1A OS=Rattus norvegicus OX=10116 GN=Oas1a PE=2 SV=1
15	E9Q9A9	8.71e-69	236	742	0.251	0.174	OAS2_MOUSE 2'-5'-oligoadenylate synthase 2 OS=Mus musculus OX=10090 GN=Oas2 PE=1 SV=1
16	P11928	5.19e-67	222	367	0.268	0.376	OAS1A_MOUSE 2'-5'-oligoadenylate synthase 1A OS=Mus musculus OX=10090 GN=Oas1a PE=1 SV=2
17	P29728	7.72e-67	231	719	0.247	0.177	OAS2_HUMAN 2'-5'-oligoadenylate synthase 2 OS=Homo sapiens OX=9606 GN=OAS2 PE=1 SV=3
18	Q5MYU0	4.67e-65	226	733	0.237	0.166	OAS2_RAT 2'-5'-oligoadenylate synthase 2 OS=Rattus norvegicus OX=10116 GN=Oas2 PE=2 SV=1
19	F8VPW7	2.58e-62	207	306	0.235	0.395	F8VPW7_HUMAN 2'-5'-oligoadenylate synthetase 1 OS=Homo sapiens OX=9606 GN=OAS1 PE=1 SV=2
20	F1N3B8	4.34e-62	218	714	0.232	0.167	OAS2_BOVIN 2'-5'-oligoadenylate synthase 2 OS=Bos taurus OX=9913 GN=OAS2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10790 DUF2604	4.8e+02	12.6	Protein of Unknown function (DUF2604)
2	PF10421 OAS1_C	2.2e-74	260.7	2'-5'-oligoadenylate synthetase 1, domain 2, C-terminus
3	PF11976 Rad60-SLD	5.2e-05	34.3	Ubiquitin-2 like Rad60 SUMO-like
4	PF02023 SCAN	34	15.7	SCAN domain
5	PF00088 Trefoil	4.1e+02	12.2	Trefoil (P-type) domain
6	PF00240 ubiquitin	1.5e-15	68.0	Ubiquitin family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000257570

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000381601	0.999	Interferon-induced GTP-binding protein Mx1
2	9606.ENSP00000333657	0.997	Interferon-induced GTP-binding protein Mx2
3	9606.ENSP00000360869	0.997	Interferon-induced protein with tetratricopeptide repeats 1
4	9606.ENSP00000369213	0.997	Probable ATP-dependent RNA helicase DDX58
5	9606.ENSP00000360883	0.995	Interferon-induced protein with tetratricopeptide repeats 3
6	9606.ENSP00000360891	0.994	Interferon-induced protein with tetratricopeptide repeats 2
7	9606.ENSP00000368699	0.994	Ubiquitin-like protein ISG15
8	9606.ENSP00000380697	0.994	Interferon regulatory factor 7
9	9606.ENSP00000371471	0.993	Radical S-adenosyl methionine domain-containing protein 2
10	9606.ENSP00000342513	0.991	Plays a role in apoptosis, negatively regulating the intrinsinc apoptotic signaling pathway and TNFSF10-induced apoptosis . However, it has also been shown to have a pro-apoptotic activity . Has an antiviral activity towards hepatitis C virus/HCV by inhibiting the EGFR signaling pathway, which activation is required for entry of the virus into cells . ECO:0000269\|PubMed:17823654, ECO:0000269\|PubMed:25757571,
11	9606.ENSP00000360860	0.991	Interferon-induced protein with tetratricopeptide repeats 5
12	9606.ENSP00000395590	0.986	Interferon-induced 35 kDa protein
13	9606.ENSP00000354822	0.985	XIAP-associated factor 1
14	9606.ENSP00000306565	0.982	Interferon-stimulated gene 20 kDa protein
15	9606.ENSP00000356530	0.977	2-5A-dependent ribonuclease
16	9606.ENSP00000354394	0.972	Signal transducer and activator of transcription 1-alpha/beta
17	9606.ENSP00000386187	0.972	Interferon-induced transmembrane protein 1
18	9606.ENSP00000380073	0.968	Interferon regulatory factor 9
19	9606.ENSP00000483430	0.968	Interferon alpha-inducible protein 27, mitochondrial
20	9606.ENSP00000245414	0.966	Interferon regulatory factor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0003725	0.998	double-stranded RNA binding
GO:0016922	0.968	nuclear receptor binding
GO:0003677	0.934	DNA binding
GO:0046966	0.711	nuclear thyroid hormone receptor binding
GO:0003824	0.301	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050794	0.996	regulation of cellular process
GO:0050896	0.995	response to stimulus
GO:0051716	0.994	cellular response to stimulus
GO:0023052	0.979	signaling
GO:0007154	0.979	cell communication
GO:0009615	0.979	response to virus
GO:0007165	0.973	signal transduction
GO:0010033	0.968	response to organic substance
GO:0071310	0.964	cellular response to organic substance
GO:0034097	0.959	response to cytokine
GO:0019221	0.938	cytokine-mediated signaling pathway
GO:0048518	0.921	positive regulation of biological process
GO:0002831	0.828	regulation of response to biotic stimulus
GO:0045088	0.775	regulation of innate immune response
GO:0098542	0.771	defense response to other organism
GO:0048519	0.629	negative regulation of biological process
GO:0140546	0.606	defense response to symbiont
GO:0050778	0.544	positive regulation of immune response
GO:0048522	0.532	positive regulation of cellular process
GO:0009966	0.463	regulation of signal transduction
GO:0071704	0.429	organic substance metabolic process
GO:0051607	0.425	defense response to virus
GO:0050792	0.413	regulation of viral process
GO:1903900	0.390	regulation of viral life cycle
GO:0048525	0.388	negative regulation of viral process
GO:0032103	0.369	positive regulation of response to external stimulus
GO:0006807	0.367	nitrogen compound metabolic process
GO:0045071	0.361	negative regulation of viral genome replication
GO:0031349	0.361	positive regulation of defense response
GO:0045089	0.349	positive regulation of innate immune response
GO:0044238	0.339	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	0.998	nucleoplasm
GO:0016020	0.997	membrane
GO:0043232	0.994	intracellular non-membrane-bounded organelle
GO:0032991	0.912	protein-containing complex
GO:0005730	0.909	nucleolus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]